KEGG   Nocardioides sp. JS614: Noca_3482Help
Entry
Noca_3482         CDS       T00443                                 

Definition
(GenBank) Formamidopyrimidine-DNA glycolase
  KO
K05522  endonuclease VIII [EC:3.2.2.- 4.2.99.18]
Organism
nca  Nocardioides sp. JS614
Pathway
nca03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:nca00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Noca_3482
Enzymes [BR:nca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Noca_3482
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Noca_3482
DNA repair and recombination proteins [BR:nca03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Noca_3482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH zf-FPG_IleRS Fapy_DNA_glyco zinc_ribbon_9 OrfB_Zn_ribbon
Motif
Other DBs
NCBI-ProteinID: ABL82982
JGI: Noc3482
UniProt: A1SME7
Position
complement(3692409..3693257)
Genome map
AA seq 282 aa AA seqDB search
MPEGHTLHRLADEITATFAGRVVRTGSPQGRFADSAALVDGQVLVGAEAWGKHLFIAFPD
ERFVHIHLGLYGKLDLVAGVEQVPAAVGQVRLRIVAADRSWHAYADLRGATTCELVTREQ
RDAVVARSGPDPLRADADPGRAWARIRRSKAPIGGLLMDQAVLAGVGNVYRAELLFRHRI
DPQRPGNTLRVGQWQAMWDDLVVLMREGVRTGRIDTVRPEHTPEAMGRPPRRDDHGGEVY
VYRRTGQPCHVCGATVRTAELQGRNLFWCPRCQPRFRSRALQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagggccacaccctccaccgcctggccgacgagatcaccgcgaccttcgccggc
cgggtggtgcgcaccggcagcccgcagggccggttcgccgactcggccgccctcgtcgac
gggcaggtgctggtcggcgccgaggcctggggcaagcacctgttcatcgccttccccgac
gagcgcttcgtgcacatccacctcgggctctacgggaagctcgacctggtcgcgggcgtc
gagcaggtgccggcggcggtcgggcaggtgcgcctgcggatcgtggccgcggaccggtcc
tggcacgcgtacgccgacctgcgcggcgccacgacctgcgagctggtgacccgggagcag
cgtgacgccgtcgtcgcgcgctcgggtcccgacccgctgcgtgccgatgccgatccaggc
cgggcctgggcccggatccgccgcagcaaggcgccgatcggcggcctgctgatggaccag
gccgtgcttgccggcgtcgggaacgtctaccgggccgagctcctgttccggcaccggatc
gacccgcaacgccccggcaacacgctgcgcgtcgggcagtggcaggcgatgtgggacgac
ctggtggtgctgatgcgcgagggcgtccggaccggccggatcgacaccgtgcggcccgag
cacacgcccgaggcgatgggccggccgccgcgccgcgacgaccacgggggcgaggtctac
gtctaccgccggaccggacagccgtgccacgtctgcggcgccacggtccgcacggccgag
ctccaggggagaaacctgttctggtgtccgcgttgccagccccggttccgatcccgggca
ttacagtga

DBGET integrated database retrieval system