KEGG   Nocardioides sp. JS614: Noca_3497Help
Entry
Noca_3497         CDS       T00443                                 

Definition
(GenBank) glycosyl transferase, family 2
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_trans_2_3 Glyco_tranf_2_3 Glyco_transf_21 Chitin_synth_2 DUF5134
Motif
Other DBs
NCBI-ProteinID: ABL82997
JGI: Noc3497
UniProt: A1SMG2
Position
3705691..3707181
Genome map
AA seq 496 aa AA seqDB search
MNANSTGSEAVPPLSQAGADSLPYVRTADPGLAAYEGRFLGEVEELPTYRPTVGCIIPAY
NEAETIAGVLDSLLQQTRLPDAIHVIINNTSDDSVEIASHYAGPHTRMTPSGEQSTVIYV
HDIGKNPDKKVGALNYGYSLVETMDYLLGVDGDTTPEPDAIEHLVDEIASDDRIGGISAI
YSIDDSALDSWMAKFLIAGQRAQFSAFNMQNLLKGRNMAVLGGQFSIFSTQALRDVLRDS
HQRTPWVNDSEVEDSLLSLQIKSAGYLTKISARARAHVGGMDTLRSLDAQQVKWNFGAID
LMWPGQRGDTKGQPFHPNLRLRWFEHMSMVINITTRTLFVLLLAGSLNIHAFVFSPWWLI
PPAAAVGLNFRVARSMAFANRRDYLFAVLIVPAEAYMVIRMGHFIRAWLKFFSRQQTDNW
AAQAKAERGKGIAWTYPFVAFGVMFAVFAVVWTQFLSIPLRSDILAVCWPILGVITVLQT
AWMIIKAMKRYRGFKA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgaacagcacgggttcggaggcggtgccgccgctctcgcaggcgggggccgac
agcctgccgtacgtgcgcaccgccgaccccggcctcgccgcctacgagggccggttcctc
ggcgaggtcgaggagctgccgacgtaccgcccgaccgtcgggtgcatcatcccggcgtac
aacgaagccgagaccatcgccggcgtcctggactccctgctccagcagacccgcctgccc
gacgcgatccacgtcatcatcaacaacaccagcgacgactccgtcgagatcgccagccac
tacgccggcccgcacacccggatgaccccgtccggggaacagagcacggtcatctacgtg
cacgacatcggcaagaaccccgacaagaaggtcggtgccctcaactacggctactcgctc
gtggagacgatggactacctcctcggcgtggacggcgacaccaccccggagccggacgcc
atcgagcacctggtcgacgagatcgccagcgacgaccggatcggcggcatctccgcgatc
tactcgatcgacgacagcgccctggacagctggatggcgaagttcctgatcgcggggcag
cgggcgcagttctcggcgttcaacatgcagaacctgctcaagggccgcaacatggcggtc
ctcggcggccagttctcgatcttctcgacgcaagcgttgcgtgacgtgctgcgcgacagc
caccagcgcaccccgtgggtcaacgacagcgaggtcgaggactcgctgctctcgctgcag
atcaagagcgccggctacctcaccaagatcagcgcccgggcccgcgcgcacgtcggcggc
atggacacgctgcgctcgctggacgcccagcaggtgaagtggaacttcggcgcgatcgac
ctgatgtggcccggccagcgcggcgacaccaaggggcagcccttccaccccaacctgcgg
ctgcggtggttcgagcacatgtcgatggtcatcaacatcaccacccgcacgctgttcgtc
ctgctgctcgccggctcgctcaacatccacgcgttcgtgttcagcccgtggtggctgatc
ccgccggcggccgccgtcgggctgaacttccgcgtggcccggtcgatggccttcgccaac
cggcgcgactacctcttcgcggtgctgatcgtcccggcggaggcctacatggtgatccgg
atggggcacttcatccgggcctggctgaagttcttcagtcggcagcagaccgacaactgg
gccgcccaggccaaggccgagcgcggcaagggcatcgcctggacctaccccttcgtcgcg
ttcggcgtcatgttcgcggtgttcgcggtggtctggacgcagttcctctcgatcccgctg
cgctccgacatcctggcggtctgctggccgatcctcggcgtgatcaccgtcctgcagacc
gcctggatgatcatcaaggccatgaagcgctaccgcggcttcaaggcctga

DBGET integrated database retrieval system