KEGG   Nocardioides sp. JS614: Noca_3501Help
Entry
Noca_3501         CDS       T00443                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
nca  Nocardioides sp. JS614
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nca00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3709635..3710675)
Genome map
AA seq 346 aa AA seqDB search
MRRRPSPTASSIRPPVLMLVALVAAVLALGGCSGGGEPDDAPSSADPVADNPYAGRTGFA
DPASRTAQAAAQAKADGDVEAERVLSRLASTPQGIWLTPEEYPPGSVAPLVARVVRAADA
AGQVPTFVVYGIPDRDCTGGFSGGGLTADQYGPWVQEIADAVSGADPSVPVVAVVEPDAL
ASAIACDRRSERVRLIADAVTRLADAEVTTYVDGGHSHWIEPDQLARLLEQAGIDQARGF
ATNVSNYQTDADERAYGEQLSALLDGAHYIVDTGRNGNGSTEDWCNPTGRAYGTDPAPAP
EGDAEHLDAYVWVKPPGESDGECGGGPPAGRFWRERALEMAVSSGW
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgccgcccctcgccgaccgcctcgtcgatccggcccccggtcctgatgctggtc
gccctggtggccgccgtgctcgcgctcggcgggtgctcgggcggcggcgagccggacgac
gcgccgagcagcgcggacccggtcgcggacaacccctacgcgggccggaccggcttcgcc
gacccggcctcgcggaccgcccaggccgcagcgcaggcgaaggcggatggtgacgtcgag
gcggagcgggtcctctcccggctcgccagcacgccgcaaggcatctggctgacgcccgag
gagtacccgcccggctcggtcgcgccgttggtcgcgcgggtcgtccgggccgccgacgca
gccggccaggtgccgacgttcgtcgtgtacggcatccccgaccgcgactgcaccggcggc
ttctccggcggtggcctgaccgcggaccagtacgggccctgggtgcaggagatcgcggac
gccgtctcgggcgccgacccctcggtcccggtcgtggcggtcgtcgagccggacgcgctc
gcctcggcgatcgcgtgcgaccgccgctcggagcgggtgcggctgatcgccgacgccgtg
acccggctcgccgacgccgaggtgacgacctacgtcgacggcggccactcgcactggatc
gagccggatcagctggcgaggctgctcgagcaggccgggatcgaccaggcccggggcttc
gccaccaacgtctcgaactaccagaccgacgccgacgagcgtgcgtacggcgagcagctc
agcgccctgctcgacggagcccactacatcgtcgacaccggacggaacggcaacggctcg
accgaggattggtgcaacccgaccggtcgggcctacggcaccgacccggcgccggcgccg
gagggcgacgcggagcacctcgacgcctacgtctgggtcaagccgccgggggagagcgac
ggcgagtgcggaggcgggccgcccgccgggcgcttctggcgtgagcgggcgctggagatg
gccgtctcgtccgggtggtga

DBGET integrated database retrieval system