KEGG   Nocardioides sp. JS614: Noca_3509Help
Entry
Noca_3509         CDS       T00443                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2236
Motif
Other DBs
NCBI-ProteinID: ABL83009
JGI: Noc3509
UniProt: A1SMH4
Position
3716357..3717580
Genome map
AA seq 407 aa AA seqDB search
MSICSLYRGVMTDLLPTPTRFGSDPAWARRAARPLRLVAGRRPEPTPAELDRMRAALLRR
DDEAHALVRAVREEHSVTMPQFRQALEHGIGSVPGAPPALRRFFAVVDARPAWVDDALLD
RGARAMQKLGWDGFDLLTWGSLLGGYRSAAALEPLVRSGRLLGASTARRTAETSRWFLAC
IEDDGMRRGSEGWRLTVHVRVMHAFVNYQLEQDPTWDWELRGTPINQYDQASTLAVFSTT
PLLQARLLGIRVSRRDSRAVMHLWSYIGWLLGVEDHWLPHTEQAGRRIIYHLLAHDPGPD
ESSRVLARALVDSQADVPGGGWRGVLAREAGLSSATFLNGRTGMHELGLPARLPWYPALR
IPVNLLWTHLVGRLPGGEALVVRRGRRGRDRRVRLQHGRLAEVPQPG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttgctcactttatcgtggtgtcatgactgacctgctcccgacgcccacccgg
ttcggctccgaccccgcgtgggcccgccgcgccgcgcggccgctccgcctggtcgccggt
cgccgccccgagccgacgccggcggagctggaccgcatgcgggccgcgctgctgcgccgc
gacgacgaggcccacgcgctggtccgggcggtgcgcgaggagcactcggtgacgatgccg
cagttccgccaggccctcgagcacggcatcgggtcggtgcccggggcgccgccggcgctg
cgccggttcttcgcggtcgtggacgctcgccccgcgtgggtcgacgacgcgctcctcgac
cgcggcgcccgggccatgcagaagctcggctgggacgggttcgacctgctcacctggggc
tcactgctgggcggctaccgctccgccgccgccctggagcccctcgtgcggtccgggcgg
ctgctcggcgcgagcaccgcccgtcgtacggcggagacgagccgctggttcctcgcctgc
atcgaggacgacgggatgcggcggggctcggaggggtggcggctcaccgtgcacgtgcgg
gtgatgcacgcgttcgtgaactaccagctcgagcaggaccccacctgggactgggagctg
cgcggcaccccgatcaaccagtacgaccaggccagcacgctcgccgtcttcagcaccacc
cccctgctccaggcccggttgctgggcatccgggtcagccgccgtgattcacgcgcggtc
atgcacctgtggagctacatcggctggctgctcggggtcgaggaccactggctgccgcac
acggagcaggccgggcggcggatcatctaccacctgctcgcccacgaccccgggccggac
gagagcagccgggtgctcgcgcgggccctggtcgacagccaggcggacgtgccgggcggg
gggtggcgcggtgtcctggcccgcgaggccgggctgagctcggcgaccttcctcaacggg
cgcaccggcatgcacgagctcggcctgcccgcgcggctgccgtggtacccggcactccgc
atcccggtgaatctgctgtggacccatctagtcggccgactccccggcggcgaggccctg
gtggtgcgccgcgggcggcgcggtcgcgaccgccgggtccggctccagcacggtcggctg
gccgaagtaccacagcccggctga

DBGET integrated database retrieval system