KEGG   Nocardioides sp. JS614: Noca_3518Help
Entry
Noca_3518         CDS       T00443                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00010  Glycolysis / Gluconeogenesis
nca00020  Citrate cycle (TCA cycle)
nca00260  Glycine, serine and threonine metabolism
nca00280  Valine, leucine and isoleucine degradation
nca00620  Pyruvate metabolism
nca00630  Glyoxylate and dicarboxylate metabolism
nca00640  Propanoate metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01200  Carbon metabolism
Module
nca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_3518
   00020 Citrate cycle (TCA cycle)
    Noca_3518
   00620 Pyruvate metabolism
    Noca_3518
   00630 Glyoxylate and dicarboxylate metabolism
    Noca_3518
   00640 Propanoate metabolism
    Noca_3518
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noca_3518
   00280 Valine, leucine and isoleucine degradation
    Noca_3518
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Noca_3518
Exosome [BR:nca04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Noca_3518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 HI0933_like FAD_oxidored FAD_binding_2 GIDA K_oxygenase FAD_binding_3 NAD_binding_8 Thi4 Amino_oxidase 3HCDH_N AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABL83018
JGI: Noc3518
UniProt: A1SMI3
Position
complement(3729951..3731345)
Genome map
AA seq 464 aa AA seqDB search
MTHFNVLVLGAGPGGYVAAIRAAQLGQTVAVIEEKYWGGVCLNVGCIPSKALLRNAEIAH
IITKEKDTFGISGEATMDFGATHKRSRGVAEASAKGVHYLMKKNKITELDGWGTIKSPRE
VEVDKDGQKQTYTCDNLIIATGARVRMLPGMSVSQNVVTYEEQILTDQLPKSIIIGGSGA
IGVEFAYVLTNFGVDVTIVEFLDRMVPTEDADVSKELLKQYKKLGVKVLLSTKVDQVEDT
GSGVRVTVSPAAGGDAQVLEADKMLAAFGFAPRIEGYGLENAGVEVSDRGAIEVDARGRT
SVENVYAIGDVTGKLMLAHTAEAMGVVAAETIAGAETHEIDFDMIPRATFCQPQIASFGY
SEAQAKEKGYDVKVATFPFSANGKARGMAEGVGFVKIVADATYNEIVGAHMIGPEVTELL
PALTLAQQWDLTADEVARNVFAHPTLSEAMKEAVEGIAGHMINL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacttcaacgtcctcgtcctcggtgccggccccggtgggtacgtcgccgccatc
cgcgccgcccagctgggccagaccgtcgccgtcatcgaggagaagtactggggcggcgtg
tgcctcaacgtcgggtgcatcccctcgaaggcgctgctgcgcaacgccgagatcgcccac
atcatcacgaaggagaaggacaccttcgggatcagcggcgaggcgacgatggacttcggt
gccactcacaagcgcagccgcggtgtggcggaggcgagcgccaagggcgtgcactacctg
atgaagaagaacaagatcaccgagctcgacggctggggcacgatcaagagcccgcgcgag
gtcgaggtcgacaaggacggccagaagcagacctacacctgtgacaacctgatcatcgcc
accggcgcacgggtccggatgctgccgggcatgagcgtgagccagaacgtcgtcacctac
gaggagcagatcctcaccgaccagctcccgaagtcgatcatcatcggcggctccggcgcg
atcggcgtggagttcgcctacgtgctcaccaacttcggcgtcgacgtcacgatcgtggag
ttcctcgaccggatggtcccgaccgaggacgcggacgtctccaaggagctgctcaagcag
tacaagaagctcggcgtgaaggtgctgctctcgaccaaggtcgaccaggtcgaggacacc
ggctccggcgtccgggtcaccgtcagcccggcggccggcggcgacgcgcaggtcctcgag
gccgacaagatgctcgcggcgttcggcttcgcgccgcggatcgagggctacggcctcgag
aacgccggggtcgaggtcagcgaccgcggcgcgatcgaggtggacgcccgcggccgcacc
agcgtcgagaacgtctacgcgatcggcgacgtcaccggcaagctgatgctggcccacacc
gcggaggcgatgggggtcgtggccgcggagacgatcgccggcgccgagacccacgagatc
gacttcgacatgatcccgcgcgcgacgttctgccagccgcagatcgcctcgttcggctac
tccgaggcccaggccaaggagaaggggtacgacgtcaaggtcgcgacgttcccgttcagc
gccaacggcaaggcccgcggcatggccgagggcgtcggcttcgtgaagatcgtcgcggac
gcgacgtacaacgagatcgtcggcgcgcacatgatcggcccggaggtcaccgagctgctg
cccgccctgacgctggcccagcagtgggacctgaccgccgacgaggtcgcccgcaacgtc
ttcgcccacccgacgctctcggaggcgatgaaggaggccgtcgagggcatcgccggccac
atgatcaacctgtga

DBGET integrated database retrieval system