KEGG   Nocardioides sp. JS614: Noca_3535Help
Entry
Noca_3535         CDS       T00443                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nca  Nocardioides sp. JS614
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Noca_3535 (deoA)
Enzymes [BR:nca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Noca_3535 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3745401..3746687)
Genome map
AA seq 428 aa AA seqDB search
MPDHDAVEVIAAKRDRHELTDSQIDWVVDAYTRGAVADEQMSSLAMAILLNGMNRREIAR
WTAAMIASGERMDFSSLSRPTADKHSTGGVGDKITLPLAPLVAACGVAVPQLSGRGLGHT
GGTLDKLEAIPGWRAALSNDEMMAQLESVGAVICAAGDGLAPADKKLYALRDVTGTVEAI
PLIASSIMSKKIAEGTGSLVLDVKVGTGAFMKDIDSARELAETMVALGTDAGVHTVALLT
DMSTPLGRTAGNAIEVAESVEVLAGGGPADVVELTLALAREMLAGAGRDDVDPADKLADG
SAMDAWKAMIRAQGGDPDAALPQARESHVVSAPASGVLTRLDAMAVGLAAWRLGAGRARK
EDPVQAGAGVVWHARPGDAVTEGQPLFTLLTDDEHRFERALDSLGGGYDIAPADSPYTPT
PLVIDRIA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaccatgacgccgtcgaggtgatcgccgccaagcgcgaccgccacgagctgacc
gacagccagatcgactgggtggtcgacgcctacaccaggggtgcggtcgccgacgagcag
atgtcgtcgctcgcgatggccatcctgctcaacgggatgaaccggcgcgagatcgcccgc
tggaccgccgcgatgatcgcgtcgggggagcggatggacttctcctcgctctcgcggccg
accgccgacaagcactccaccggcggggtcggcgacaagatcacgctgccgctcgcgccg
ctggtcgccgcctgcggggtcgccgtcccgcagctctccgggcgcggcctgggccacacg
ggtggcaccctcgacaagctcgaggccatccccggctggcgggcggccctgtcgaacgac
gagatgatggcgcagctcgagtcggtgggtgcggtgatctgcgcggccggcgatgggctg
gcgcccgcggacaagaagctctacgcgctgcgcgacgtgaccggcaccgtcgaggcgatc
ccgctgatcgcctcctcgatcatgtccaagaagatcgccgagggcaccggctcactggtg
ctcgacgtcaaggtcggcaccggcgcgttcatgaaggacatcgactccgcgcgcgagctc
gccgagacgatggtcgcgctcggcacggacgcgggcgtccacacggtcgcgctcctgacc
gacatgtctacccccctggggcgcaccgccggcaacgcgatcgaggtcgccgagtcggtg
gaggtgctcgccggcggcggcccggccgacgtcgtggagctgaccctggcgctggcccgc
gagatgctggccggcgcgggtcgcgacgacgtcgacccggccgacaagctggccgacggc
tccgcgatggacgcctggaaggcgatgatccgggcccagggcggcgaccccgacgccgcg
ctcccgcaggcgcgggagagccatgtcgtcagtgctcccgcgtccggcgtgctgacccgg
ctggacgcgatggccgtcgggctggccgcctggcggctgggcgccggccgggcccgcaag
gaggacccggtgcaggccggcgccggcgtcgtctggcacgcccgccccggggacgccgtc
accgaggggcagccgctgttcacgctgctcaccgacgacgagcaccggttcgagcgggcc
ctggactcactcgggggcggctacgacatcgcgcccgcggactcgccgtacaccccgacg
ccgctggtgatcgaccggatcgcctga

DBGET integrated database retrieval system