KEGG   Nocardioides sp. JS614: Noca_3561Help
Entry
Noca_3561         CDS       T00443                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABL83061
JGI: Noc3561
UniProt: A1SMM6
Position
complement(3776860..3777690)
Genome map
AA seq 276 aa AA seqDB search
MSRQISGMSIIVTGGARGIGRATVERFARQGASVAIGDLDAELAEEVAAAYGDRVVAARL
DVTDPASWREFLGEVAHLGPWDVLVNNAGIMPLGSVLKEPDEVTRAIFNVNVHGPINGTK
AVAPGMAERGHGHIVNVASAVGRLAVADGASYSASKFAVVGFSEATRAELGPLGIDVSLV
LPTVVQTELSAGIPAAKGVPPVTADDVAAVIESVVRKPRAEVWVPRWVQGPTKVTQALPR
RVQDAMARAMGADDVLAKADPAARAAYEQRARRGAE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcgtcagatctccggcatgtccatcatcgtgacgggcggcgcccgcggcatcggg
agggccacggtcgagcggttcgcccggcagggcgcctcggtcgccatcggcgacctcgac
gccgagctggccgaggaggtcgcggcggcgtacggcgaccgcgtggtcgccgcgcggctc
gacgtcaccgacccggcctcgtggcgggagttcctcggcgaggtcgcccacctcgggccg
tgggacgtgctggtcaacaacgccggcatcatgccgctcggctcggtgctcaaggagccc
gacgaggtgacccgggcgatcttcaacgtcaacgtgcacggtccgatcaacggcacgaag
gcggtcgcgccggggatggccgagcgcggccacggccacatcgtcaacgtcgcctccgcc
gtcggccggctcgcggtcgccgacggcgcgtcgtactccgcctcgaagttcgccgtcgtc
gggttcagcgaggccacccgggccgagctcggaccgctcggcatcgacgtctccctggtg
ctgccgacggtggtgcagaccgagctctccgccggcatcccggccgcgaagggcgtgccg
ccggtgacggccgacgacgtcgccgcggtcatcgagagcgtcgtgcgcaagccgcgggca
gaggtgtgggtgccgcgctgggtgcaggggccgaccaaggtcacccaggcgctgccgcgg
cgggtccaggacgcgatggccagggcgatgggcgccgacgacgtgctcgcgaaggcagac
ccggccgcacgcgcggcgtacgaacagcgcgcccggcgcggcgcggaatag

DBGET integrated database retrieval system