KEGG   Nocardioides sp. JS614: Noca_3564Help
Entry
Noca_3564         CDS       T00443                                 

Definition
(GenBank) transposase IS3/IS911 family protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_1 TSC22 HTH_Tnp_ISL3 HTH_28 HHH_5
Motif
Other DBs
NCBI-ProteinID: ABL83064
JGI: Noc3564
UniProt: A1SE78
Position
3780735..3781046
Genome map
AA seq 103 aa AA seqDB search
MPKKIDPAVKERCVRQVLEHLPEYPSLTAAAESVARREGLGKETVRRWVVQAQIDGGQRQ
GATSEELAEIKELKAKVRRLEEDNEILRRASIFFAGELDPRNR
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagaagatcgatcccgcagtcaaggagcggtgcgtgcggcaggtgctggagcac
ctgccggagtacccgtcgctgaccgcggccgccgagtccgtcgcacgccgcgaaggcctc
gggaaggagaccgtgcgccggtgggtcgtccaggcccagatcgacggcggccagcgccag
ggcgcaaccagcgaggagctcgctgagatcaaggagctcaaagccaaggtccgtcggctc
gaggaagacaacgagatcctccgccgggcctcaattttcttcgcgggggaactcgacccc
cgcaatcgctga

DBGET integrated database retrieval system