KEGG   Nocardioides sp. JS614: Noca_3566Help
Entry
Noca_3566         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIR_2 TIR
Motif
Other DBs
NCBI-ProteinID: ABL83066
JGI: Noc3566
UniProt: A1SMN1
Position
complement(3781989..3782807)
Genome map
AA seq 272 aa AA seqDB search
MQHAFLSYVHENAEAVEQLASVLRAAGIPVWKDTEALWPGEDWKQKIRSAIEDGSLAFVA
CFSTSSVSKTRTFMNEELALAVDQFRLRPPGHVWLLPVRLDDCELPNYDLGGGRTLNSLQ
RIDLFGPNREANLARLVAAVMGIFGTSTTSPATIAAAIATANDAERGPRLAEALKLGMTD
PTKVMETEDLFLGEVKTVIEALKDQERFPLGGGAAPNVVAVVERAQEYDQLVTPLAHAAI
TLGAWGAEEHAGLVTLKRLRFCAAPMRVAALG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcacgcgttcctctcctacgttcacgaaaacgccgaggccgtcgagcagttggcg
tcggtgctacgtgcggcagggattccggtgtggaaggacaccgaggccctgtggcccggc
gaggactggaagcagaagatccggtcggcgatcgaggatggctccctggcgttcgtcgcc
tgcttctcaacgagtagcgtctccaagaccaggactttcatgaacgaggagctggcgctg
gcggtcgaccagtttcggctccggccacccggccatgtttggcttcttccggttcggctg
gacgactgtgagcttccgaactacgacctcggtggcggtcggacactcaacagcctccag
cgcatcgaccttttcggtccgaaccgcgaagccaatcttgctcggttggtcgctgccgtc
atgggcatatttggcacgtcgaccacatcgccagccacgatcgcagcggccatcgcgacg
gcgaacgatgccgagcgcggcccacgtttggcggaagcactcaagctgggtatgaccgac
cccaccaaggtgatggagacggaggatctgttcctcggcgaagtgaagacggttatcgaa
gcgctcaaggaccaagaacgtttcccgttgggcgggggcgcggcaccaaacgtggtggcc
gtggtcgagcgcgcccaggagtacgaccaacttgtgacgccgctcgcccatgctgcaatc
acgctcggcgcctggggtgccgaagagcacgccggcctcgtcaccctgaagcgcctcagg
ttctgtgccgctcctatgcgggttgcggctctcggttga

DBGET integrated database retrieval system