KEGG   Nocardioides sp. JS614: Noca_3583Help
Entry
Noca_3583         CDS       T00443                                 

Definition
(GenBank) phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00230  Purine metabolism
nca00670  One carbon pool by folate
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01130  Biosynthesis of antibiotics
Module
nca_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Noca_3583
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Noca_3583
Enzymes [BR:nca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     Noca_3583
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     Noca_3583
Exosome [BR:nca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Noca_3583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AICARFT_IMPCHas MGS
Motif
Other DBs
NCBI-ProteinID: ABL83083
JGI: Noc3583
UniProt: A1SMP8
Position
complement(3800072..3801649)
Genome map
AA seq 525 aa AA seqDB search
MSEPVSTPEHRIPIRRALVSVYDKTDLEDLVRGLHDAGVELVSTGGSAKLIEGLGLPVTK
VEDLTGFPECLDGRVKTLHPRVHAGILADRRLDSHVQQLADLGVEPFDLVVSNLYPFRET
VASGATPDECVEQIDIGGPSMVRAAAKNHPSVAIVTSPERYADVLAAVAAGGFTLEQRKV
LAAEAFTHTAAYDVAVAGWFASTYVPAEDGWPEFAGETWQKAAVLRYGENPHQDAALYTD
SSGGGGLAGAEQLHGKEMSYNNYVDTDAARRAAYDFDEPAVAIIKHANPCGIAVGADVAE
AHRRAHECDPVSAFGGVIAVNRPVSVEMARQVADVFTEVIVAPSYDEGAVEILQGKKNIR
ILRCADPAEERSTELRQISGGVLVQVRDHVDATGDDPSTWTLAAGEPASAEVLADLAFAW
TACRAAKSNAILLAKDGASVGIGMGQVNRVDSCRLAVSRAGDRAAGSVAASDAFFPFEDG
PQILIDAGVTAIVQPGGSVRDELTVEAAKAAGVTMYFTGTRHFFH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaacccgtgtccacgcccgagcaccgcatcccgatccgccgcgccctcgtctcc
gtctacgacaagaccgacctcgaggacctggtccgcggcctgcacgacgccggcgtcgag
ctggtgtcgacgggcggctcagcgaagctgatcgagggcctgggcctcccggtcaccaag
gtcgaggacctgaccggcttcccggagtgcctcgacggccgggtcaagacgctgcacccg
cgcgtgcacgcggggatcctcgccgaccggcgcctggactcccacgtccagcagctcgcc
gacctcggggtggagccgttcgacctggtggtctccaacctctacccgttccgcgagacc
gtcgcgtcgggcgccacgcccgacgagtgcgtggagcagatcgacatcggcgggccctcg
atggtccgggccgccgccaagaaccacccgtccgtggcgatcgtgacctcgccggagcgg
tacgccgacgtgctggcggccgtcgccgcaggcgggttcaccctcgagcagcgcaaggtg
ctggcagccgaggcgttcacccacaccgcggcctacgacgtcgcggtcgcgggctggttc
gcctcgacgtacgtgccggccgaggacggctggcccgagttcgccggggagacctggcag
aaggccgccgtgctgcggtacggcgagaacccgcaccaggacgccgccctctacaccgat
tcgtcagggggcggcggtctggccggggccgagcagctgcacggcaaggagatgtcctac
aacaactacgtcgacaccgacgcggcgcggcgcgcggcgtacgacttcgacgagcctgcc
gtcgcgatcatcaagcacgccaacccgtgtggcatcgccgtcggcgccgacgtcgccgag
gcccaccgccgcgcccacgagtgcgacccggtcagcgccttcggcggcgtgatcgcggtc
aaccggcccgtctcggtcgagatggcccgccaggtggccgacgtgttcaccgaggtgatc
gtcgcgccgtcgtacgacgagggcgcggtcgagatcctgcagggcaagaagaacatccgc
atcctgcgctgcgccgacccggccgaggagcgctccaccgagctgcgccagatcagcggc
ggcgtgctcgtgcaggtgcgtgaccacgtcgacgcgacgggcgacgacccgtcgacctgg
acgctggccgcgggggagcccgcctcggcggaggtgctcgccgacctcgcgttcgcctgg
acggcgtgccgcgccgcgaagtccaacgcgatcctgctcgccaaggacggcgcctcggtc
ggcatcggcatgggccaggtcaaccgggtcgactcctgccggctcgccgtctcgcgggcc
ggggaccgggccgcgggatcggtcgccgcctccgacgcgttcttccccttcgaggacggc
ccgcagatcctcatcgacgccggcgtcaccgcgatcgtgcagccgggcggctcggtccgt
gacgagctcacggtcgaggcggccaaggccgccggcgtcaccatgtacttcaccggcacc
cggcacttcttccactga

DBGET integrated database retrieval system