KEGG   Nocardioides sp. JS614: Noca_3588Help
Entry
Noca_3588         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABL83088
JGI: Noc3588
UniProt: A1SMQ3
Position
3806471..3807427
Genome map
AA seq 318 aa AA seqDB search
MRDPIEELENFTVPGPPMTPLPAAEVRRRGNRIRRRNNALAGAAAVAVLAAVVTPVALLA
GDHQDRDVQPAPAVSWQQEVPDDFPLATDLFGDPPVTAESGVDDIVLCGTTAWSPADPVA
TVDLAGARFEENEAYLGRTLALYADGATAEQALAALRSGVEDCARDENGTGLPLVQETVP
VDLGEDGFAFIQRSKDGDLLAELTLWEVVRSGNALYLDTSYGAAGDDQAVATAISNMTHR
SEVVRAQLCVFSADPCAQPGLESESPSPSPSIGEGAVGAIPPRSTEGSLDSAAQSVPDVT
EANRGLVPALCRFTERGC
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacccgatcgaggagctcgagaacttcaccgtcccaggacctcccatgactccc
ctccccgccgccgaggtgcgccgacgcggcaaccggatccgccggcgcaacaacgcgctg
gccggcgccgccgccgtcgccgtcctcgctgccgtcgtcacgccggtcgcgctgctcgcc
ggagaccaccaggaccgcgacgtccagcccgcgccggcggtcagctggcagcaggaggtg
cccgacgacttcccgctcgcgaccgacctcttcggtgacccgcccgtcaccgcggagtcc
ggggtcgacgacatcgtgctgtgcgggacgaccgcctggtcacccgccgacccggtggcg
accgtcgacctcgccggcgcgcgcttcgaggagaacgaggcctacctcggccgcacgctc
gccctgtacgccgacggcgccaccgctgagcaggccctcgccgcgctgcgctcgggcgtc
gaggactgcgcgcgggatgagaacggcaccgggctgccgctggtgcaggagaccgtcccg
gtcgacctcggcgaggacggtttcgcgttcatccagcgctcgaaggacggcgacctgctc
gccgagctcacgctctgggaggtcgtccggtccgggaacgcgctctacctcgacacctcc
tacggcgccgccggcgacgaccaggccgtggcgacggcgatctcgaacatgacccaccgc
tccgaggtggtccgggcccagctgtgcgtgttctcggccgacccgtgcgcccagccgggg
ctcgagtccgaatcgccgtcgccgtcgccgagcatcggcgagggcgcggtcggcgcgatc
ccgccccgctcgaccgagggctcgctcgacagcgccgcccagagcgtccccgacgtcacc
gaggccaaccggggcctggtccccgccctctgccgcttcaccgagcgcggctgctga

DBGET integrated database retrieval system