KEGG   Nocardioides sp. JS614: Noca_3604Help
Entry
Noca_3604         CDS       T00443                                 

Definition
(GenBank) ATP-binding region, ATPase domain protein
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
nca  Nocardioides sp. JS614
Pathway
nca02020  Two-component system
nca02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:nca00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Noca_3604
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Noca_3604
Enzymes [BR:nca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Noca_3604
Protein kinases [BR:nca01001]
 Histidine kinases
  CheA family [OT]
   Noca_3604
Two-component system [BR:nca02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Noca_3604
Bacterial motility proteins [BR:nca02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Noca_3604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW HATPase_c Hpt H-kinase_dim RHH_1 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ABL83104
JGI: Noc3604
UniProt: A1SMR9
Position
complement(3820849..3823077)
Genome map
AA seq 742 aa AA seqDB search
MEEIDEIVQEFLVESHENLDQLDRDLVALEREPGSRDLLGSIFRTIHTIKGTSGFLAFGN
LESVTHVGENLLARLRDGKQSMTPQTTDVLLAMVDKVRELLAVIEDCGTEGDIDVTEVVE
RITAVLEGNAAPTPIAELLPEPEAAVEVEAEVAAEPVPTPTPTATAVEATEEVSSTRRNV
AESSIRVDVELLDTLMRLVGELVLTRNQIVRQAGDQDDLDLTRSAQRLNLIATELQEGVM
KTRMQPIDHLWSKLPRVVRDLGAACGKSVTLAMVGRETELDRSLLESVKDPLTHLVRNAV
DHGLEDPAGRIAAGKPAEGVLTLRAYHEGGQVVVEVCDDGAGIDADRIAEKALASGLRTT
AQLAQMSPADILQLIFLPGFSTAQSVTNVSGRGVGMDVVKTNIEAIGGTIEVESVVGRGT
TCRLRIPLTLAIVPALTVECAGDRYAIPQVSLLELVALDADRAATAVEDVNGASVYRLRG
ALLPLVRLTDVLGVESDRSDGHVLIAVLQAEGKRFGLVIDRVLSTEEIVVKPLTSRLKSL
GTYSGATILGDGRVALILDVQALARRALTAEALERGAAGTAAEETKTSREHLRMLVAGIG
GGRRVAIPLSSVTRLENIAASTVEVVGSREVVQYRGAILPLLRLDRHLGAISERAGDDLV
VVVYSAGARSVAIVVDEIIDIVDEESEVHSDIDDHGLVGSTLIRDRIVEVLDVRAAILAA
DPKFYSDSDVEIDLRDELQEAV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
gtggaagagatcgacgagatcgtccaggagttcctcgtggagagccacgagaacctcgac
cagctcgatcgcgacctggtcgcgctcgagagggagcccgggtcccgtgacctgctgggc
agcatcttcaggaccatccacaccatcaaggggaccagcgggttcctggcgttcggcaac
ctcgagtcggtgacccacgtcggggagaacctcctcgcccgtctgcgcgacggcaagcag
tcgatgaccccgcagaccaccgacgtgctgctcgcgatggtcgacaaggtgcgcgagctc
ctggcagtgatcgaggactgcggcaccgagggcgacatcgacgtcaccgaggtcgtggag
cggatcaccgcggtgctcgagggcaacgccgccccgacccccatcgccgagctgctgccc
gagcccgaggccgcggtggaggtcgaggccgaggtcgccgccgagccggtgcccaccccc
acgcccactgccacggccgtcgaggcgaccgaggaggtctcgtcgacccgccggaacgtc
gccgagtcctcgatccgcgtcgacgtcgagctgctcgacaccctgatgcgcctggtcggt
gagctggtgctcacccgcaaccagatcgtgcggcaggccggcgaccaggacgacctcgac
ctgacccggtcggcccagcgcctcaacctgatcgcgaccgagctgcaggagggagtcatg
aagacccgcatgcagccgatcgatcatctctggtcgaagctgccgcgcgtcgtgcgcgac
ctcggcgcggcctgcggcaagagcgtcaccctggccatggtgggccgggagaccgagctc
gaccgctcgctcctggagtccgtcaaggacccgctgacccacctggtccgcaacgcggtc
gaccacggcctcgaggaccccgcgggccggatcgcagccgggaagcccgctgagggcgtg
ctgaccctgcgcgcctaccacgagggcggccaggtggtcgtcgaggtctgcgacgacgga
gcgggcatcgacgccgaccggatcgccgagaaggcgctggccagcggcctgcgcaccacc
gcccagctcgctcagatgtcgcccgccgacatcctccagctgatcttcctccccgggttc
tcgaccgcgcagtcggtcacgaacgtctccgggcgcggcgtcggcatggacgtcgtgaag
accaacatcgaggccatcggcgggaccatcgaggtcgagtccgtcgtcggccggggcacc
acctgccggctgcggatccccctgacgctggcgatcgtgccggcgctcaccgtggagtgt
gcgggcgaccggtatgcgatcccacaggtcagcctgctggagctggtcgcgctggacgcc
gaccgggccgccactgcggtcgaggacgtcaacggcgcgtccgtctaccgcctgcgcggc
gccctgctcccgctggtccgcctcaccgacgtcctcggtgtcgagtccgaccggtccgac
gggcacgtgctcatcgcggtgctccaggccgagggcaagcgcttcggcctggtcatcgac
cgggtgctcagcaccgaggagatcgtggtcaagccgctgacctcccggctgaagtcgctg
gggacctactccggcgcgaccatcctcggtgacggccgggtggccctgatcctcgacgtc
caggcgctcgcccgacgggcgctcaccgccgaggccctcgagcgcggcgccgccggcacc
gccgccgaggagaccaagacgtcccgggagcacctgcggatgctggtcgccggcatcggt
ggcggccgccgcgtcgcgatcccgctctcctcggtcacccgcctcgagaacatcgcggcc
agcacggtcgaggtggtgggcagccgcgaggtcgtccagtaccgcggcgcgatcctgccg
ctgctgcggctggaccggcacctcggcgcgatcagcgagcgcgccggcgacgacctggtg
gtcgtcgtctactcggccggcgcacgcagcgtcgcgatcgtggtcgacgagatcatcgac
atcgtcgacgaggagtccgaggtccacagcgacatcgacgaccacggcctggtcggctcc
acgctgatccgcgaccggatcgtcgaggtcctcgacgtacgcgcggcgatcctcgccgcc
gacccgaagttctactccgactcggacgtcgagatcgatctccgcgacgagctccaggag
gcggtgtga

DBGET integrated database retrieval system