KEGG   Nocardioides sp. JS614: Noca_3611Help
Entry
Noca_3611         CDS       T00443                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2339
Motif
Other DBs
NCBI-ProteinID: ABL83111
JGI: Noc3611
UniProt: A1SMS6
Position
3827809..3828318
Genome map
AA seq 169 aa AA seqDB search
MSDSEQSPEENPKSGRRETEEERLDRKWEDLLQELRVMQTGAQLLAGFLLTLPFQDKFDT
LDDFQTGLYLALVLLATLTTALIMGPVAIHRRLSGRHVKERLVASAHVLVWGVLTAIALL
VTGIVMFIFDMVIDLTWASVAAAAMALVLVTLLVLLPHRLMGGEKNRST
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagcgagcagtcccccgaggagaacccgaagtcgggtcggcgggagaccgag
gaggagcggctcgaccgcaagtgggaggacctgctccaggagctgagggtcatgcagacc
ggcgcgcagttgctcgccggcttcttgctgacgctcccgttccaggacaagttcgacacc
ctcgacgacttccagaccgggctctacctcgcgctggtgctgctggccaccctcaccacg
gcgctgatcatgggaccggtcgccatccaccgccggctgtccggacgacacgtcaaggag
cggctggtcgcctccgcccacgtgctcgtctggggcgtcctgaccgcgatcgccctgctg
gtgaccgggatcgtgatgttcatcttcgacatggtcatcgacctgacctgggccagcgtg
gcggcggcggcgatggcgctggtgctggtgaccctgctggtcctgctcccccaccggctc
atgggcggggagaagaaccggtcgacatag

DBGET integrated database retrieval system