KEGG   Nocardioides sp. JS614: Noca_3672Help
Entry
Noca_3672         CDS       T00443                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00860  Porphyrin and chlorophyll metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Noca_3672
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Noca_3672
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Noca_3672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 HI0933_like Pyr_redox_2 FAD_oxidored Thi4 F420_oxidored AlaDh_PNT_C FAD_binding_3 Pyr_redox NAD_binding_9 GIDA TrkA_N Lycopene_cycl Pyr_redox_3 ApbA UDPG_MGDP_dh_N 3HCDH_N Trp_halogenase NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABL83172
JGI: Noc3672
UniProt: A1SMY7
Position
complement(3894320..3895702)
Genome map
AA seq 460 aa AA seqDB search
MSRVVVIGAGIAGLTAARDLADAGQDVVVLESSPRAGGKLRRDQVAGVTVDVGAEAMLNR
RPEGVGLAARLGLPLEHPTVASSRIWTRGELRPLPRSLMGIPLDLPQLEQSGVLSAEGLA
RVRAEPTLWPERFEPPDGDVSVGDLVDRRFGPEVTDRLVEPLLGGVYAGHARLISARASV
PQLLDYASRGSVLEQAAAIPTTYDRPVFAGIPGGMGRLPEALADGLPAAGAVVRTGATVR
GLARTPTGFALTVGPTTAPELVEADAVVLALPAAPAARLLADVAPAAATELAAVESASMV
VVTFAFRGSDVPALAATDSSGFLVPPVDGRRVKAATFSFAKWGWVRAAGDGLLLLRTSLG
RHREETALQATDEELVAWSLADLAEAVGPLAAPADTHVQRWGGGLPQYAVGHLDRVSRIR
AAVAAVPGLAVCGAAYDGVGIPAVIGSARRAAAEVLALRP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagggtcgtcgtcatcggcgccgggatcgccggcctgaccgcggcacgcgacctc
gccgacgccgggcaggacgtggtcgtactggagtcctcgccccgggccggcggcaagctc
cgccgtgaccaggtcgccggcgtcacggtcgacgtcggcgccgaggccatgttgaaccgc
cgccccgagggtgtcggcctggcggcccgcctcgggctgcctctcgagcatccgaccgtc
gcctcgtcccggatctggacccgcggggagctgcggccgctgccgcgctcgctgatgggc
atcccgctggacctgccccagctggagcagtcgggtgtgctctcggccgagggcctggcc
cgggtgcgtgccgagccgacgctgtggccggaacggttcgaaccgcccgacggcgacgtc
tcggtcggcgacctggtcgaccgccggttcgggcccgaggtcaccgaccgactggtcgag
ccgctgctcggcggggtgtacgccgggcacgcgcggctgatctcggcgcgcgcgtcggtg
ccgcagctgctcgactacgcgtcccgcggctcggtcctcgagcaggccgccgcgatcccg
acgacctacgaccggccggtgttcgccgggatcccgggtgggatgggccggctgcccgag
gcgctcgccgacgggctgccggccgcgggtgccgtcgtccgcaccggcgccacggtccgc
gggctcgcccgcacccccaccggcttcgccctcaccgtcggcccgaccaccgcccccgag
ctggtcgaggccgacgcggtcgtcctggccctgcccgccgcaccggccgcccggctgctc
gccgacgtggcgccggccgccgccaccgagctggcggccgtcgagtcggcgtcgatggtc
gtggtgacgttcgcgttccgcggcagcgacgtacccgccctcgcggcgacggactcctcg
ggcttcctcgtcccgcccgtggacggccgccgcgtcaaggccgcgaccttctcgttcgcg
aagtggggctgggtccgtgccgcaggcgacgggctgctcctgctgcgcacctcgctcggt
cggcaccgcgaggagacggcgctgcaggcgaccgacgaggagctcgtggcctggtcgctc
gccgacctcgccgaggccgtcgggccgctcgccgcgccggccgacacccacgtgcagcgt
tggggcggtggcctgccgcagtacgccgtcggccacctcgaccgggtgtcccggatccgg
gccgcggtcgccgcggtgccgggtctcgccgtctgcggggcggcgtacgacggcgtgggg
atcccggccgtgatcggctccgcccgtcgcgccgccgcggaggtgctcgccctgcgcccg
tga

DBGET integrated database retrieval system