KEGG   Nocardioides sp. JS614: Noca_3819Help
Entry
Noca_3819         CDS       T00443                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nca  Nocardioides sp. JS614
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Noca_3819
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Noca_3819
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Noca_3819
Enzymes [BR:nca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Noca_3819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4038844..4040415
Genome map
AA seq 523 aa AA seqDB search
MFRHGVASGDPLPDAVLIWTRVTPTAASRPGSGHGPRVEVRWEVARDADFRRVVRRGRFQ
TGPSRDHTVKVDVTGLEPATWYHYRFRYDDAVSPVGRARTAPASDASPDHLRFGVVSCAN
LQAGWFSAYRGLAARDDLHAVLHLGDYLYEYGPGEYGYGIDDEDIRSHQPAHEMLTLADY
RQRHAQYKQDPDLQALHAKYPWVITWDDHEVTNDAYREGAENHNPDLGEGDFHRRRARAH
RAYDEWMPVRMDGTAGLRDGDRLFRRLQFGRLAEISMLDLRTYRDEQVARPLPEPLPVAD
AAVSDPDRTIVGRQQLDWLKQSLSRGRAQWKIIGNPVMIAPVDFGGLPDELIDPVNDVTG
LLPRDGLPYNVDQWDGYTDDRREVFTHIRDHQVSDALFVTGDIHSGWACELPYDASTYPA
GDSAGVEFVCSSVTSNNLKDLTGTPAHTTSTAVEQTILANNRHIKYLNFDDHGFSVLDVT
PLRAQMDWYVIGDRADRDTSITWSVSYATRTGTGRVEQVGEPV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgttccgacacggggtcgcctccggcgacccgcttcccgacgccgtgctgatctggacc
cgggtgacgccgaccgccgcgagccggccggggtcgggccacggcccccgggtcgaggtc
cgctgggaggtggcgcgcgacgccgacttccgccgggtggtgcgccgcggcaggttccag
accgggccgagccgcgatcacacggtcaaggtcgacgtcaccgggctggagccggcgacc
tggtaccactaccgcttccggtacgacgacgccgtcagcccggtcggccgggcccgcacc
gccccggcgagcgacgccagcccggaccacctgcgcttcggcgtcgtgtcgtgcgcgaac
ctgcaggcgggctggttctccgcctaccggggccttgccgcgcgcgacgacctgcacgcc
gtgctgcacctcggcgactacctctacgagtacggccccggcgagtatggctacgggatc
gacgacgaggacatccgctcgcaccagccggcccacgagatgctcacgctggccgactac
cgccagcggcacgcccagtacaagcaggacccggatctgcaggcgctgcacgcgaagtac
ccgtgggtgatcacctgggacgaccacgaggtgaccaacgacgcctatcgcgagggcgcc
gagaaccacaaccccgacctcggcgagggcgacttccaccggcgccgcgcccgggcgcat
cgcgcctacgacgagtggatgccggtgcgcatggacggcaccgccgggctgcgcgacggc
gaccggttgttccggcggctgcagttcggccggctggcggagatcagcatgctcgacctg
cgcacctaccgcgacgagcaggtcgcacgcccgctccccgagccgctcccggtggccgac
gcggcggtgagcgaccccgaccgcaccatcgtgggccgccagcagctcgactggctcaag
cagtcgctctcgcgcggtcgcgcgcagtggaagatcatcggcaacccggtgatgatcgcg
ccggtggacttcggcgggctccccgacgagctgatcgacccggtcaacgacgtcaccggg
ctgctcccccgcgacggcctgccctacaacgtcgaccagtgggacgggtacaccgacgac
cgccgcgaggtcttcacgcacatccgcgaccaccaggtgagcgacgcgctgttcgtgacc
ggcgacatccactccggctgggcgtgcgagctgccgtacgacgcctcaacgtacccagcc
ggcgactccgcgggcgtggagttcgtgtgctcgtcggtcacctcgaacaacctcaaggac
ctcaccggcacgcccgcgcacaccacgagcaccgcggtcgagcagacgatcctggccaac
aaccggcacatcaagtacctcaacttcgacgaccacggcttctccgtcctggacgtgacg
ccgctgcgcgcgcagatggactggtacgtcatcggcgaccgcgccgaccgggacacctcg
atcacctggtcggtctcctacgcgacccgcaccggcaccggccgggtcgagcaggtcggg
gagccggtgtga

DBGET integrated database retrieval system