KEGG   Nocardioides sp. JS614: Noca_3987Help
Entry
Noca_3987         CDS       T00443                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Noca_3987
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noca_3987
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Noca_3987
Enzymes [BR:nca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Noca_3987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4206245..4207519)
Genome map
AA seq 424 aa AA seqDB search
MSAVVIEKTSTPGLREGAFGNATALSCRECGHQVELGPHYACPECFGPLEIAYDFPRVTR
EEIEAGPRNIWRYKALLPVPADIEDSPNTEPGFTRLLRAGNLAAELGIANLWVKDDSTNP
TNSFKDRVVACALSAAREFGSKVFACPSTGNLANAVAAAGARAGIKTVVFIPSNLEQPKQ
VNSAVFTDSLVAVNGNYDDVNRLASEIAGEEEGWAFVNVNVRPYYAEGSKTLGYEIAEQL
GWRLPDQIVIPVASGSQLTKVHKAFQELIRLGLVEDKPYRVYGAQAAGCSPVSVAYKAGV
DAIRPVKPDTIAKSLAIGNPADGIYVLDICRETGGAVEDVTDDEIRAGIVLLARTEGIFT
ETAGGTTVAVLKKLVETGQLDTSLETVVINTGHGLKTLDAVSGTVAPAATIDPSYPAFAA
TGLA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgtcgtcatcgagaagaccagcacgccgggcctgcgcgagggcgcgttcggc
aacgccaccgccctctcctgccgcgagtgcggccaccaggtcgagctcggaccgcactac
gcgtgtccggagtgcttcggccccctggagatcgcctacgacttcccccgggtcacccgc
gaggagatcgaggccggcccgcgcaacatctggcgctacaaggcgctgctgccggtgccc
gccgacatcgaggacagccccaacaccgagcccggcttcacccgcctgctgcgtgcgggc
aacctggccgccgagctcgggatcgcgaacctgtgggtcaaggacgactccaccaacccc
accaactccttcaaggaccgcgtcgtcgcctgcgcgctgagcgcggcccgcgagttcggc
agcaaggtcttcgcctgtccgagcaccggcaacctcgccaacgcggtcgccgccgcgggc
gcccgcgccggcatcaagaccgtggtgttcatcccgagcaacctcgagcagcccaagcag
gtcaactccgccgtcttcaccgactccctggtggccgtcaacggcaactacgacgacgtc
aaccggctcgcttccgagatcgccggcgaggaggagggctgggcgttcgtgaacgtcaac
gtccgcccctactacgccgagggctccaagaccctcggctacgagatcgccgagcagctc
ggctggcggctgccggaccagatcgtgatcccggtcgcgagcggctcgcagctgaccaag
gtgcacaaggccttccaggagctgatccggctcggcctcgtggaggacaagccctaccgc
gtgtacggcgcgcaggccgcgggctgctccccggtctcggtcgcctacaaggccggcgtc
gacgccatccgcccggtcaagccggacacgatcgccaagagcctggcgatcggcaacccc
gccgacggcatctacgtcctcgacatctgccgcgagaccggcggcgcggtcgaggacgtc
accgacgacgagatccgcgccggcatcgtgctgctggcccgcaccgaggggatcttcacc
gagaccgccggcggcaccaccgtcgccgtgttgaagaagctcgtcgagaccggccagctc
gacacctcgctcgagaccgtggtgatcaacaccggccacggcctgaagaccctggacgcg
gtctccggcaccgtggcgcccgccgcgaccatcgacccgtcgtaccctgccttcgccgcc
accggcctggcctga

DBGET integrated database retrieval system