KEGG   Nocardioides sp. JS614: Noca_3987Help
Entry
Noca_3987         CDS       T00443                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nca01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nca00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:nca00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4206245..4207519)
Genome map
AA seq 424 aa AA seqDB search
MSAVVIEKTSTPGLREGAFGNATALSCRECGHQVELGPHYACPECFGPLEIAYDFPRVTR
EEIEAGPRNIWRYKALLPVPADIEDSPNTEPGFTRLLRAGNLAAELGIANLWVKDDSTNP
TNSFKDRVVACALSAAREFGSKVFACPSTGNLANAVAAAGARAGIKTVVFIPSNLEQPKQ
VNSAVFTDSLVAVNGNYDDVNRLASEIAGEEEGWAFVNVNVRPYYAEGSKTLGYEIAEQL
GWRLPDQIVIPVASGSQLTKVHKAFQELIRLGLVEDKPYRVYGAQAAGCSPVSVAYKAGV
DAIRPVKPDTIAKSLAIGNPADGIYVLDICRETGGAVEDVTDDEIRAGIVLLARTEGIFT
ETAGGTTVAVLKKLVETGQLDTSLETVVINTGHGLKTLDAVSGTVAPAATIDPSYPAFAA
TGLA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgtcgtcatcgagaagaccagcacgccgggcctgcgcgagggcgcgttcggc
aacgccaccgccctctcctgccgcgagtgcggccaccaggtcgagctcggaccgcactac
gcgtgtccggagtgcttcggccccctggagatcgcctacgacttcccccgggtcacccgc
gaggagatcgaggccggcccgcgcaacatctggcgctacaaggcgctgctgccggtgccc
gccgacatcgaggacagccccaacaccgagcccggcttcacccgcctgctgcgtgcgggc
aacctggccgccgagctcgggatcgcgaacctgtgggtcaaggacgactccaccaacccc
accaactccttcaaggaccgcgtcgtcgcctgcgcgctgagcgcggcccgcgagttcggc
agcaaggtcttcgcctgtccgagcaccggcaacctcgccaacgcggtcgccgccgcgggc
gcccgcgccggcatcaagaccgtggtgttcatcccgagcaacctcgagcagcccaagcag
gtcaactccgccgtcttcaccgactccctggtggccgtcaacggcaactacgacgacgtc
aaccggctcgcttccgagatcgccggcgaggaggagggctgggcgttcgtgaacgtcaac
gtccgcccctactacgccgagggctccaagaccctcggctacgagatcgccgagcagctc
ggctggcggctgccggaccagatcgtgatcccggtcgcgagcggctcgcagctgaccaag
gtgcacaaggccttccaggagctgatccggctcggcctcgtggaggacaagccctaccgc
gtgtacggcgcgcaggccgcgggctgctccccggtctcggtcgcctacaaggccggcgtc
gacgccatccgcccggtcaagccggacacgatcgccaagagcctggcgatcggcaacccc
gccgacggcatctacgtcctcgacatctgccgcgagaccggcggcgcggtcgaggacgtc
accgacgacgagatccgcgccggcatcgtgctgctggcccgcaccgaggggatcttcacc
gagaccgccggcggcaccaccgtcgccgtgttgaagaagctcgtcgagaccggccagctc
gacacctcgctcgagaccgtggtgatcaacaccggccacggcctgaagaccctggacgcg
gtctccggcaccgtggcgcccgccgcgaccatcgacccgtcgtaccctgccttcgccgcc
accggcctggcctga

DBGET integrated database retrieval system