KEGG   Nocardioides sp. JS614: Noca_4541Help
Entry
Noca_4541         CDS       T00443                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nca  Nocardioides sp. JS614
Brite
Enzymes [BR:nca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Noca_4541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4804671..4805237
Genome map
AA seq 188 aa AA seqDB search
MAPDRVDEAFAAVPREWFLPVSERDRASYDGPIEIGHGQTNSQPRTVAAMLRLLEVRPGD
RVLDVGSGSGWTTGLLAELTGSAGRVLGLELEPELVAFGRANLTHGGWDWARIDQATPGV
YGAPAGAPYDRILVSAEARELPTSLVEQLARPGRLVVPVNGEMLLVVVDAGAEPTVTKHG
WYRFVPLR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgaccgggtcgacgaggcgttcgcggcggtgccgcgcgagtggttcctgccc
gtgagcgagcgcgaccgggcgtcgtacgacgggccgatcgagatcggccacgggcagacc
aactcccagccgcgcacggtcgccgcgatgctgcggctactggaggtccggcccggcgac
cgggtcctcgacgtcggctcgggctcgggctggaccaccgggctgctggccgagctgacc
ggatccgccggccgggtgctgggcctggagctggagcccgagctggtggcgttcggacgg
gccaacctgacccacggcggctgggactgggcgcggatcgaccaggcgacgcccggcgtg
tacggcgcaccggcgggcgcgccgtacgaccggatcctggtgtcggccgaggcgcgcgag
ctgccgacctccctggtcgagcagctggcccggcccggccggctggtggttccggtgaac
ggcgagatgctgctggtcgtcgtggacgccggcgcggagccgaccgtcaccaagcacggc
tggtaccggttcgtgccactgcgctga

DBGET integrated database retrieval system