KEGG   Nocardioides sp. JS614: Noca_4562Help
Entry
Noca_4562         CDS       T00443                                 

Definition
short chain enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35 4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
nca  Nocardioides sp. JS614
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noca_4562
   01212 Fatty acid metabolism
    Noca_4562
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Noca_4562
   00650 Butanoate metabolism
    Noca_4562
  Lipid metabolism
   00071 Fatty acid degradation
    Noca_4562
   01040 Biosynthesis of unsaturated fatty acids
    Noca_4562
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Noca_4562
   00310 Lysine degradation
    Noca_4562
   00380 Tryptophan metabolism
    Noca_4562
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Noca_4562
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Noca_4562
   00281 Geraniol degradation
    Noca_4562
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Noca_4562
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Noca_4562
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Noca_4562
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Noca_4562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4828113..4830323)
Genome map
AA seq 736 aa AA seqDB search
MTETQTQSAVRYEKDADGIVTLTLDDPTSSANTMNELYLESMAAAVQRLYDEVETVTGVV
VASAKKTFFAGGNLKNMVRATKADADSVFAMGEAVKAGLRRLEQFPRPVVAAINGAALGG
GFEICLATNHRIVVDDDSVKLGLPESTLGLLPGGGGVTRIVRLLGLQSGLMDVLLTGTQF
KPSAAKEKGLVDELVATREELVPAAKAWIKANPEESQNPWDKPGYKMPGGSPTSPALAGF
LPAFPALLRKQTKGAVYPAPRAILSAAVEGALVDFDTASRIESRYLTNLIVNQGSKNMIQ
AFFFDLQAINSGSLRPQGIPPYRAVKVGVLGAGMMGAGIAYSCARSGMEVVLKDVAVESA
EKGKAYSEKLLDKAIAKGRSTEEKKAELLGRITATADAADLAGCDLVIEAVFEDPSLKQQ
VFAEIAPYVDQDALLCSNTSTLPITELASGVDRPADFIGLHFFSPVDKMPLVEIIRGAKT
SDVALAKAYDVVQQIRKTPIVVNDSRGFYTSRVIGTQVMEGLAMVAEGLHPVSIERAGTQ
AGYPVGPLQLTDELNMELMAKIQKANADAAEREGRTWESSAGEQVVAKMIELGRPSRLKG
AGFYEYDEAGRRQGVWAGLAEAFPRSEQPIPLQDMKDRMLFIEALETAKCFEEGVLASSA
AANIGSIMGIGFPAMTGGAAQFMQGYEAPSDSGAAGQIGLGAFVARADELAEKYGERFRP
TAYLRDLAASNGSFPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacccagacccagagcgccgttcgctacgagaaggacgcggacggcatcgtc
accctcaccctcgacgaccccacgtcgagcgcgaacaccatgaacgagctctacctcgag
tcgatggcggccgcggtccagcggctgtacgacgaggtcgagaccgtgacgggcgtcgtg
gtcgccagcgcgaagaagaccttcttcgccggcggcaacctcaagaacatggtccgggcg
accaaggccgacgcggactcggtgttcgcgatgggcgaggccgtcaaggccggcctgcgc
cggctcgagcagttcccccgtccggtcgtcgcggcgatcaacggcgccgcgctcggcggc
gggttcgagatctgcctggccaccaaccaccggatcgtcgtcgacgacgacagcgtcaag
ctcggcctgcccgagtcgaccctgggcctgctgcccggcggtggcggggtcacccgcatc
gtgcggctgctcggcctgcagtcagggctgatggacgtgctgctgaccggcacccagttc
aagccgtcggccgccaaggagaagggcctggtcgacgagctggtcgccacccgcgaggag
ctggtcccggcggcgaaggcctggatcaaggccaaccccgaggagagccagaacccctgg
gacaagcccggctacaagatgcccggcggctcgccgacgtccccggcgctggccggattc
ctgccggccttcccggcgctgctgcgcaagcagaccaagggcgcggtctacccggcgccg
cgggcgatcctgtcggccgcggtcgagggcgcgctggtcgacttcgacaccgcgtcccgg
atcgagtcgcggtacctgacgaacctgatcgtcaaccagggctcgaagaacatgatccag
gcgttcttcttcgacctgcaggcgatcaactccggatcgctgcgcccgcaggggatcccg
ccgtaccgcgcggtcaaggtcggcgtcctcggcgcgggcatgatgggcgccggcatcgcc
tactcctgtgcccgctccggcatggaggtcgtgctcaaggacgtcgccgtcgagagtgcc
gagaagggcaaggcctactcggagaagctgctcgacaaggcgatcgccaagggccgcagc
accgaggagaagaaggccgagctgctcggccggatcaccgccaccgcggacgccgcggac
ctggccggctgcgacctcgtgatcgaggccgtcttcgaggacccgtcgctcaagcagcag
gtcttcgccgagatcgcgccgtacgtcgaccaggacgcgctgctgtgctcgaacacctcg
acgctcccgatcaccgagctcgcgtcgggcgtggaccggcccgccgacttcatcggcctg
cacttcttcagccccgtcgacaagatgccgctggtcgagatcatcaggggcgcgaagacc
tcggacgtcgcgctggccaaggcgtacgacgtggtccagcagatccggaagaccccgatc
gtcgtcaacgacagccgcggcttctacacctcccgggtgatcggcacgcaggtgatggag
ggcctcgccatggtcgcggagggtctgcacccggtgtcgatcgagcgcgcgggcacgcag
gccggctacccggtcggcccgctgcagctgaccgacgagctcaacatggagctgatggcc
aagatccagaaggcgaacgccgacgcggccgagcgtgagggccgcacctgggagtcctcc
gccggtgagcaggtcgtcgcgaagatgatcgagctcggccgtccgtcccggctcaagggg
gccgggttctacgagtacgacgaggccggccggcggcagggcgtctgggcgggcctcgcg
gaggcgttcccgcgcagcgagcagccgatcccgctgcaggacatgaaggaccggatgctg
ttcatcgaggcgctcgagaccgcgaagtgcttcgaggagggcgtgctcgcaagttcggcc
gcggccaacatcggctcgatcatgggcatcggcttcccggcgatgaccggcggtgccgcg
cagttcatgcagggctacgaggccccgtctgattctggggctgccggccagatcgggctg
ggcgcgttcgtcgcccgcgccgacgagctggccgagaagtacggcgagcggttccgcccc
acggcgtacctgcgcgacctggccgcgtcgaacgggtccttcccggcctga

DBGET integrated database retrieval system