KEGG   Nocardioides sp. JS614: Noca_4819Help
Entry
Noca_4819         CDS       T00443                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
nca  Nocardioides sp. JS614
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Noca_4819
Enzymes [BR:nca01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Noca_4819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pNOCA01:144855..145823
Genome map
AA seq 322 aa AA seqDB search
MNLPDLPRLPLVLAPTPLVPAPRLSEILGLDVWFKRDDLTGRGLGGNKVRPLEYLLGDAK
TKGCDALVTGAGPQSNWAMLAALTAHGAGIAPHLVFYGDPQHPTGNLLLAQLAGADIHYT
GELDRGSVDPALFKAADELTDAGHLPYVVPRGGATPIGCLGYVRATAELLAQLAETGLSP
ASIWLATGSGGTQAGLVAGAQWSGWEIDVIGITTSRSPEEAASRVRDLASATLDLIGVGD
TSIAAPQVRGGYLGEGYGKASPAGAAAAQLVAQTEGVFLDPAFGAKAMAALIDAARDGTV
EGPVVFLVTGGAPTLFTPGAQL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcccgatctcccacgtctccccctggtactcgcgccgacgccgctcgtacca
gccccgcggctatccgaaattctcggactcgacgtgtggttcaagcgggacgatctcact
ggtcgaggccttggcgggaacaaggttcgtcccctcgagtacctgctcggcgatgcaaag
accaagggctgcgacgccctcgtgacaggcgccggaccgcagtccaactgggcaatgctg
gcagccctgaccgcgcacggagcgggcatcgccccccacctcgtcttctacggtgaccca
cagcacccgacaggtaacctgctgctcgcccagctcgccggcgcagacatccactacacc
ggcgaactcgatcgcggatctgtcgacccggcgctgttcaaggccgccgacgaactcacc
gatgcaggccacctgccttacgtggtaccgcgaggcggggcgacgcccatcgggtgcctc
ggctatgtccgcgccacagcggaactgcttgcccagctggccgaaacgggcctttctcca
gcgtccatatggctggccacagggtccggcggcacccaagctggactcgtcgccggagcc
cagtggtccggctgggagatcgatgtcatcgggatcacgacgagccgatctcccgaggag
gcggcgtcccgggtgcgagacctggcctcagcgacgctcgacttgatcggagtcggcgac
acctccattgcagcaccccaggtgcgcggagggtatctcggtgagggctatggcaaggcc
tccccggcgggagctgctgcagcccagctcgtcgctcagaccgaaggcgtcttcctcgac
ccagccttcggagcaaaagcgatggcagccctgatcgatgcagcccgtgatggcaccgtt
gagggtccggtggtgttcctcgtcaccggaggggccccgaccctcttcactcccggagct
caactgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system