KEGG   Nocardioides sp. JS614: Noca_4850Help
Entry
Noca_4850         CDS       T00443                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nca  Nocardioides sp. JS614
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Noca_4850
Enzymes [BR:nca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Noca_4850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pNOCA01:complement(182394..183050)
Genome map
AA seq 218 aa AA seqDB search
MTSTAAISTDRATGPAVDQVAARRWRPRVTHPGPEIDAGAAEQAAADLLTALGLDLTDEN
LTETPRRMAQALIEMTSGADFALTTFPNDEGYDELVLVRDIPLQSVCEHHMLPFVGIAHI
GYLPGDRILGLSKFARMVDLHARRPQTQERLTKRIADHLQEALQPHGVGVVIEAEHTCMS
LRGARAAGARTTTSALFGRLRDDPRSRAEFLALTRSTP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaccgccgccatctccaccgaccgggcaaccggccccgctgtcgaccaggtc
gcggcgcggcggtggcggccacgtgtcacgcacccggggcccgagatcgacgccggcgcg
gcggagcaggccgccgccgacctgctcaccgccctggggctggacctgaccgacgagaac
ctcaccgagacaccgcggcgcatggcccaggcgctgatcgagatgaccagcggagcggac
ttcgcgctgaccacgttccccaacgacgagggctacgacgagctcgtcctcgtcagggac
atccctctgcagtcggtgtgcgagcaccacatgctgcccttcgtcggcatcgcccacatc
ggctatcttcccggtgaccgcatcttgggactgtcgaagttcgcccggatggtcgacctc
cacgcacgccgaccccagacgcaggaacggctcaccaaacgcatcgccgaccacctccaa
gaggcgctgcagccgcacggcgtcggtgtcgtcatcgaggccgagcacacctgcatgagc
ctgcgcggcgcccgagcagcaggcgcccgcaccacgacatcggcactgttcggccggctc
cgcgacgacccccgcagccgcgctgagttcctcgccctcaccaggagcacgccatga

DBGET integrated database retrieval system