KEGG   Nocardioides sp. JS614: Noca_4850Help
Entry
Noca_4850         CDS       T00443                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00790  Folate biosynthesis
nca01100  Metabolic pathways
Module
nca_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Noca_4850
Enzymes [BR:nca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Noca_4850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABL79433
JGI: Noc4850
UniProt: A1SC98
Position
pNOCA01:complement(182394..183050)
Genome map
AA seq 218 aa AA seqDB search
MTSTAAISTDRATGPAVDQVAARRWRPRVTHPGPEIDAGAAEQAAADLLTALGLDLTDEN
LTETPRRMAQALIEMTSGADFALTTFPNDEGYDELVLVRDIPLQSVCEHHMLPFVGIAHI
GYLPGDRILGLSKFARMVDLHARRPQTQERLTKRIADHLQEALQPHGVGVVIEAEHTCMS
LRGARAAGARTTTSALFGRLRDDPRSRAEFLALTRSTP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaccgccgccatctccaccgaccgggcaaccggccccgctgtcgaccaggtc
gcggcgcggcggtggcggccacgtgtcacgcacccggggcccgagatcgacgccggcgcg
gcggagcaggccgccgccgacctgctcaccgccctggggctggacctgaccgacgagaac
ctcaccgagacaccgcggcgcatggcccaggcgctgatcgagatgaccagcggagcggac
ttcgcgctgaccacgttccccaacgacgagggctacgacgagctcgtcctcgtcagggac
atccctctgcagtcggtgtgcgagcaccacatgctgcccttcgtcggcatcgcccacatc
ggctatcttcccggtgaccgcatcttgggactgtcgaagttcgcccggatggtcgacctc
cacgcacgccgaccccagacgcaggaacggctcaccaaacgcatcgccgaccacctccaa
gaggcgctgcagccgcacggcgtcggtgtcgtcatcgaggccgagcacacctgcatgagc
ctgcgcggcgcccgagcagcaggcgcccgcaccacgacatcggcactgttcggccggctc
cgcgacgacccccgcagccgcgctgagttcctcgccctcaccaggagcacgccatga

DBGET integrated database retrieval system