KEGG   Notothenia coriiceps (black rockcod): 104941314Help
Entry
104941314         CDS       T04920                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ncc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    104941314 (mgll)
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104941314 (mgll)
Peptidases [BR:ncc01002]
 Serine Peptidases
  Family S33
   104941314 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 301 aa AA seqDB search
MPEPGAAPRRSPQGVPYSDLQHLVNADGLHLFCRYWEPAGPPRALVYIAHGAGEHCGPYD
EIAQRLKELSMLAFAHDHVGHGQSEGERMNVKDFQVYIRDSLQHVDLMKSRHPGLPVFIV
GHSMGGAISILTACERPSEFSGVVLIAPMVQMNPDSATPFKVFMAKVLNHMVPSLTLGTI
DSKWVSRDMKQVEAYDADELNFHGGMRVSFAMQLMGAAARIEREIPSISWPFLLLHGDTD
KLCDIRGSKLMHENAASSDKKFKVFEGAYHALHHDLPEVSESTLKEVTGWITDRIPAVTS
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagccgggagctgctccgcggcggagcccgcagggagtcccctacagcgacctg
cagcacctcgtcaacgccgacggactgcacctgttctgccgctactgggagcccgccggc
ccgccaagggctctggtgtatattgcccatggagctggggagcattgtgggccgtatgat
gagatcgcacaaagactgaaggaactgtccatgctggcgtttgcgcacgaccacgttggc
catggtcagagtgaaggagagaggatgaatgtcaaagacttccaggtatacatcagagac
tcgctgcagcacgttgacctgatgaaatcccgccacccgggcctgcccgtcttcatcgtc
ggtcactccatgggtggtgccatctccatcctgacggcctgtgagaggcccagtgaattc
tctggagtggttctgatcgctccgatggtccagatgaacccggactcggccacaccgttc
aaggtttttatggcaaaggtcctcaaccacatggtgcccagcctcactctgggcaccatc
gactccaaatgggtgtcacgcgacatgaagcaggtggaggcgtatgacgccgatgagctg
aacttccacgggggcatgcgggtgtcgttcgccatgcagctgatgggggcggcggcgcgc
atcgagagggagatcccctccatcagctggcccttcctgctcctgcacggcgacaccgac
aagctctgcgacatcagaggctccaagctgatgcacgagaacgccgcgagctccgacaag
aaattcaaggtcttcgagggggcctaccacgcccttcaccacgacctcccggaggtgtct
gagtccacgctgaaggaggtgaccggatggatcacagatcgcatcccagctgtgacatcg
ccgtaa

DBGET integrated database retrieval system