KEGG   Notothenia coriiceps (black rockcod): 104954176Help
Entry
104954176         CDS       T04920                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104954176
Peptidases [BR:ncc01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   104954176
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104954176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 330 aa AA seqDB search
DSECWQYTLRSRWWLKRGLLALVIFLLVPCLQRTLPELIQHLVYTHRVRVPFFIDLSRPS
DLSLNHTVNMYLTSEEGISLGVWHTVPESKWKEAQGKDLAWYQNTLRDGSPVFIYLHGNT
GTRAAAHRIGVAKVLSALGYHVLVPDYRGFGDSTGEPTEAGVTTDALYVYNWAKERSGDS
LVVIWGHSLGTGVATNAAVKLHEQGRSFDGVILEGAFNTKGQEVPTFTWYYWRLPGSGYL
FPDPVEENKALFPSEENLKKMTCPILFLHSEDDHLAPIQTVQEMYELAVTAQNAERVKMV
PFDGSLGYLHNGLYRDPHLPDSLQKFVLSL
NT seq 994 nt NT seq  +upstreamnt  +downstreamnt
agattcagagtgttggcagtacactttaaggtcccggtggtggctgaaaagaggattatt
ggcccttgttatcttccttttggtgccctgcttgcagaggacactcccagaattaatcca
gcaccttgtttacactcacagagtcagggtgccgttctttattgacctgagccgaccctc
agatctctcccttaatcacaccgtcaacatgtacttaacatcagaggaaggaatctccct
tggcgtgtggcacactgtccctgaaagtaagtggaaggaggcacaagggaaggacttggc
atggtaccagaacactttaagggatggaagtccagtttttatatatcttcacggaaacac
aggcacaagggcagccgctcatcggatcggagtggcaaaagtattgagtgcacttggtta
ccacgtgctggtgcctgactacagagggtttggagattccaccggggagccgactgaggc
cggtgtgaccacagatgccctctacgtttacaactgggccaaagagcgcagcggggacag
cctggtcgtcatctggggacactctcttggcaccggagtggccactaatgctgcagttaa
actgcatgagcaagggaggagttttgatggtgtgattctggagggtgcattcaatactaa
aggacaggaggtgccgacttttacctggtattactggaggcttccaggctctggatactt
attcccagatccagttgaagaaaacaaggctttatttccttctgaagaaaacttgaagaa
aatgacatgcccgatccttttcctccattcagaggacgatcacttggctccaattcagac
tgttcaggagatgtatgagttagcagtgacggcccagaatgcagagcgggtcaagatggt
gccatttgacggttctctggggtatctgcacaacggcttatatcgagacccccatctgcc
tgacagcttacagaagtttgtcctgtcgctgtaa

DBGET integrated database retrieval system