KEGG   Notothenia coriiceps (black rockcod): 104961219Help
Entry
104961219         CDS       T04920                                 

Definition
(RefSeq) monoacylglycerol lipase abhd6-B-like
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104961219
Peptidases [BR:ncc01002]
 Serine Peptidases
  Family S33
   104961219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 161 aa AA seqDB search
PVSQNSSFSYSQEVRGTQRSQASSPGGECSPRPSVVGRTGQRASGDGQDGDAASTRCFVK
SIGLDKTPFHLVGTSMGGNVAGVYAAHHPAHLSGVTLMCPAGLVFPTESEFIVRLREMEK
TQQQGSIPLIPTTTQELESMLKLCCYTPISLPKQVQYDVRV
NT seq 488 nt NT seq  +upstreamnt  +downstreamnt
atccagtgtcccagaactcgtccttctcctactcccaggaggtgagaggcacgcagcgct
cccaggcctcctccccggggggcgagtgctcacctcggccctctgtggtgggacgcaccg
gccagagagccagtggagacggacaggacggagacgcagcgtccaccaggtgttttgtga
agagtattggtttggacaaaacacccttccacctggtggggacgtcgatgggggggaacg
tcgctggagtgtacgctgcccatcaccctgctcacctgtccggcgtcaccctgatgtgtc
cggcaggtctggttttccccacagagtctgagttcatcgttcgcctgagggagatggaga
agactcagcagcaggggtcgatccctctgatccccactactactcaggagctggagtcca
tgttgaagctctgctgctacaccccaatcagcctccccaagcaggtacagtacgatgtga
gggtctaa

DBGET integrated database retrieval system