KEGG   Nosema ceranae: NCER_100030Help
Entry
NCER_100030       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nce  Nosema ceranae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCER_100030
   01230 Biosynthesis of amino acids
    NCER_100030
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCER_100030
   00051 Fructose and mannose metabolism
    NCER_100030
   00562 Inositol phosphate metabolism
    NCER_100030
Enzymes [BR:nce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NCER_100030
Exosome [BR:nce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NCER_100030
  Exosomal proteins of bladder cancer cells
   NCER_100030
  Exosomal proteins of melanoma cells
   NCER_100030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 236 aa AA seqDB search
MKPIVVGNWKANKNFEVFNKIPSNLNNIEVAIALPHIYIPQTVNYSKHHISISGQDCSKF
ESGPYTGETPASFLKENHAKYVIIGHSERRRYFYENSSDFTTKINNALAAGLGVIYCIGE
NSLERESNEYMKVLYDQFFSVVGQGIKIDIAYEPVWAIGSGIIPKKEEISEVIEHIQRWS
RSINVSGRILYGGSVSYDNIELLHSINKLKGFLIGGISLKTEFVDICEKYNSLNGQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatagttgtaggaaattggaaagctaacaaaaacttcgaagtctttaataaa
ataccatcaaatctaaataatattgaagttgctatagcactccctcacatctatattccg
caaacagttaattattctaaacatcatatttcgatttcgggacaagattgtagtaaattt
gaaagtggcccttacacgggagaaacacccgcttcttttctgaaagaaaatcatgccaaa
tatgtaatcataggacattcagagagaagaagatacttttatgaaaattcatcagatttc
acaaccaagattaataatgcacttgcggcaggacttggagtaatctattgcattggagaa
aattctttagagcgtgaaagtaatgaatatatgaaagtattgtatgatcaatttttttcg
gtagtaggacaagggattaaaatcgatatcgcttatgagccagtatgggcgataggatca
ggtattattccgaaaaaagaagaaatttctgaggtaattgaacacatccaaagatggtct
agaagtattaatgtatctggtagaatattatatggtggttctgtatcttatgataacatt
gaattattacacagtataaataaacttaagggatttttaataggtggaatttctttaaaa
acagaattcgttgatatctgtgagaagtataatagtttaaatggccagtaa

DBGET integrated database retrieval system