KEGG   Nosema ceranae: NCER_100030Help
Entry
NCER_100030       CDS       T01614                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nce  Nosema ceranae
Pathway
nce00010  Glycolysis / Gluconeogenesis
nce00051  Fructose and mannose metabolism
nce00562  Inositol phosphate metabolism
nce01100  Metabolic pathways
nce01110  Biosynthesis of secondary metabolites
nce01130  Biosynthesis of antibiotics
nce01200  Carbon metabolism
nce01230  Biosynthesis of amino acids
Module
nce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nce_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCER_100030
   00051 Fructose and mannose metabolism
    NCER_100030
   00562 Inositol phosphate metabolism
    NCER_100030
Enzymes [BR:nce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NCER_100030
Exosome [BR:nce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NCER_100030
  Exosomal proteins of bladder cancer cells
   NCER_100030
  Exosomal proteins of melanoma cells
   NCER_100030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: EEQ83169
UniProt: C4V6J8
AA seq 236 aa AA seqDB search
MKPIVVGNWKANKNFEVFNKIPSNLNNIEVAIALPHIYIPQTVNYSKHHISISGQDCSKF
ESGPYTGETPASFLKENHAKYVIIGHSERRRYFYENSSDFTTKINNALAAGLGVIYCIGE
NSLERESNEYMKVLYDQFFSVVGQGIKIDIAYEPVWAIGSGIIPKKEEISEVIEHIQRWS
RSINVSGRILYGGSVSYDNIELLHSINKLKGFLIGGISLKTEFVDICEKYNSLNGQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatagttgtaggaaattggaaagctaacaaaaacttcgaagtctttaataaa
ataccatcaaatctaaataatattgaagttgctatagcactccctcacatctatattccg
caaacagttaattattctaaacatcatatttcgatttcgggacaagattgtagtaaattt
gaaagtggcccttacacgggagaaacacccgcttcttttctgaaagaaaatcatgccaaa
tatgtaatcataggacattcagagagaagaagatacttttatgaaaattcatcagatttc
acaaccaagattaataatgcacttgcggcaggacttggagtaatctattgcattggagaa
aattctttagagcgtgaaagtaatgaatatatgaaagtattgtatgatcaatttttttcg
gtagtaggacaagggattaaaatcgatatcgcttatgagccagtatgggcgataggatca
ggtattattccgaaaaaagaagaaatttctgaggtaattgaacacatccaaagatggtct
agaagtattaatgtatctggtagaatattatatggtggttctgtatcttatgataacatt
gaattattacacagtataaataaacttaagggatttttaataggtggaatttctttaaaa
acagaattcgttgatatctgtgagaagtataatagtttaaatggccagtaa

DBGET integrated database retrieval system