KEGG   Nosema ceranae: NCER_100220Help
Entry
NCER_100220       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
nce  Nosema ceranae
Brite
Enzymes [BR:nce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NCER_100220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 474 aa AA seqDB search
MYKELEWAFNNYILECKLIINENKKHVLPPSIVKNVLIPNKIGIIPHISTLLPSRFYNES
LINVHTEDELTLRFIPYLENTTHLDVQHFNDTTIYDLSYNQNNEILSRLLENSSTVEVAE
LLNIEPEYFTKQCAKMNMYECSYDSLFNEMRKYFCARCLIFGCKIHTIRTKTCFDYESEV
KCYCKDINNPAQTTLNSNLIIIEKDKIKENLKMFNNDKCLTSFNLFLKYNITISCRDLGK
KMPLYKKILRSMYSITNSNKLPEVCDHTGKCYQNARCICFTNGTGCDSKCLCTFCNYMFY
GCKCKNSCTKRCSCSKINKTCDEHCECHCDSKNMSSCEWYIPLIYKSTYIYKSAKKGLGC
FAGENIKKDEFVIEYVGEIISNDEGNRRANFYDANGLSYIFEYTDKHCLDAFLVGNNSRF
INHSTNQNLYIKKLWMKRALRICFYAARNIKLGEELFFNYNYSDEYKKKFNLID
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagaactagaatgggcatttaataattacattctagaatgtaaattgataatt
aatgaaaacaaaaagcatgtattgcctccaagtatagtaaaaaacgttttgatcccaaat
aaaatcggtataattccccatatatcgacattactaccttcaaggttttataacgaatct
ttgattaatgtacatacagaagatgaactgaccctgcgatttataccgtatttagaaaat
accacccatttagatgttcaacattttaatgatactacgatatacgatttatcgtacaat
caaaacaatgaaatattaagtaggttactagaaaatagtagcacggtagaagtagcagag
ttactgaacattgaacctgaatattttaccaaacagtgtgctaaaatgaatatgtatgaa
tgttcttatgattcgctttttaatgaaatgcgtaaatatttctgtgcgagatgtttaatt
tttggctgtaaaatccacacaattcgtacaaagacctgttttgattacgaaagcgaagtt
aaatgttactgcaaagatattaataatcctgcgcaaactactttaaattctaatttaatc
ataattgaaaaagataagattaaagaaaatttgaaaatgtttaacaatgataagtgttta
acgtcttttaatttatttttaaaatataatataacaatatcatgtagagacttgggtaaa
aaaatgccgctttataaaaaaatattaagaagcatgtattctataactaatagtaacaaa
cttcctgaagtatgtgatcacactggaaagtgttaccaaaatgcgcgatgtatttgtttt
acaaatggaacaggatgtgattcaaaatgtttgtgtactttttgtaattatatgttttac
ggttgtaagtgtaaaaatagttgtacgaaaagatgcagttgtagtaaaattaataaaaca
tgcgacgaacattgtgaatgtcattgcgacagtaaaaatatgtctagttgtgaatggtac
atacctttaatttacaagtctacatatatttacaaaagtgctaagaaaggactaggatgc
tttgctggtgaaaatattaagaaagacgagtttgtaattgaatatgttggcgaaattatt
tccaatgatgaagggaacagaagggcaaatttttatgacgcaaatggtctgtcatatata
tttgaatatactgataagcactgtttagatgcatttttagttggaaataattctaggttt
ataaaccactctactaaccaaaatttatacatcaaaaaattatggatgaagcgtgcactg
cgcatttgtttttatgcagcccgtaatataaagttaggagaagagctgttttttaattat
aattatagtgatgagtataaaaagaaatttaatttgattgattaa

DBGET integrated database retrieval system