KEGG   Nosema ceranae: NCER_100312Help
Entry
NCER_100312       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
nce  Nosema ceranae
Brite
Enzymes [BR:nce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCER_100312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MDPNDIKIGYKLFVQKPNTIVQQKAEILGIRHREDVLEFYVHYIDLNRRLDEWIPHTFLC
LNDVTKIEIPKKKKKIEDAQKKSIDLNSIDDEKENVKVKDEEYKIKNIKQIQFGKYLVEP
WYFSPYPKWITDTDIVYICEKCLYYFKHKDVYTQHCTECETEHPPGREIYRHNGISFFEM
DGYTEPRFCRNLALLSKLFLDHKSLYYDIDVFLFYVLCRIDDNGYTIVGYFSKEKISEMG
YNLACILTLPFEQRKGYGRILMDFSYMLSKKDNLISGPEKPLSDLGLLSYRAYWLDVIVD
FLVENNNSSVDEISKATHITVEDIISTLMYYNVLKLYKGKFIYALSDKLKEKAQKFKTRR
LDEKYLKYY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggatccaaatgatatcaaaatcggatacaaattatttgtgcaaaaaccaaacacaata
gttcagcaaaaggccgagatactaggtattcgtcatagagaggatgtattagaattttat
gtacattacatagatttgaacagaagacttgatgaatggattcctcatacatttttatgc
ttaaatgacgttacaaaaatagaaataccaaaaaagaaaaagaaaattgaggatgcgcaa
aaaaagtccatagatttaaatagcattgatgatgaaaaggaaaatgttaaagtcaaagat
gaagaatataaaataaaaaatattaaacagatacagtttgggaaatatcttgtagaaccc
tggtatttttctccctatcccaagtggataactgacactgatattgtttatatttgtgaa
aagtgtctgtactattttaaacataaagatgtttacactcaacattgtacagaatgtgag
acagaacatccgccaggacgtgaaatatacagacacaatggaataagcttttttgagatg
gatggatatacggaacccagattttgtagaaatcttgctttactatccaaattgttttta
gatcataaatctttatattacgacattgatgtctttttattttatgtattgtgtcgtatt
gacgataatggatatacgattgtaggatatttttctaaagaaaaaatatcagaaatgggc
tataatctggcttgtattcttactctgccttttgaacagagaaaaggctatggaagaatt
ttaatggacttttcttatatgctcagtaaaaaagacaatttgataagtggcccagaaaaa
cctttgagtgatttaggacttttgagttacagagcatattggttggatgttattgtagat
tttttagtagaaaataataactcgtctgttgatgaaatatctaaagcaactcacattact
gtagaagatattataagcactttgatgtattacaatgttttaaagctttacaaaggaaag
tttatttatgcactcagtgataaacttaaagaaaaagcacagaaatttaaaactagaaga
ttggacgagaaatatttaaaatattattaa

DBGET integrated database retrieval system