KEGG   Nosema ceranae: NCER_100505Help
Entry
NCER_100505       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
nce  Nosema ceranae
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nce00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    NCER_100505
Enzymes [BR:nce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     NCER_100505
Glycosyltransferases [BR:nce01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   NCER_100505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 657 aa AA seqDB search
MKMLTPCFIFLITFIVRTYKIEKGNFVVWDEAHFGKFASKYLTRTFYFDVHPPLGKMLTA
LGGYIFNQPTDFSFASASEYPKNFDFAGMRRFHALISSLTPVFSYLILKELRYNFTQRFL
LCMMFIFENGFTSIGRLILLDSHLLTATSAVIYCLTRVFKRNFQNTDLFFLGICLGLVLS
IKWIGCFTTALVGIFIIYTLWRLINSKMPISHVFLIFVKFSLFLIILPISIYIGIYYIHF
SIVNKTSTDEGHMSSFFQASLEGNSHKKNRKYIAYATRITLKNACLSGGYLHSHPHMYPG
KSMNQVTTYSHKDNNNNWAFQKVSESNTEPLFVTDEDKVVIYHLETARYINVSKTQSYLS
QGLLTGATTIPLTNDNVFIIETYSDTHAKEKRIKSLTTKFRLKHFTTGLYLKSTNKKYPD
WGFSQGEVVCTEDMDEGTLWTVEENISDKVTTDINPLYEEIYNKLFFKNFIEHNILQYNV
NKSFVQDENLEPDAIVSKPYEWPILRRGLRMCSWDEKSMKFYMFGNPLLWFSSTLSLFVA
PIIFITKYINFKRGAKKFRNRHNEAYEVFICVGGWLLHYLPFFAVGRVLYFHHYYPALFF
AIMSLCYVLRHLSINFVRVYIFYIIGFYAIFSPLTYGFIDSRSLKFLKFIPSWNFID
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgttaacaccttgctttatatttttaattacttttattgtaaggacatataaa
atagaaaaaggtaattttgtagtgtgggatgaagcgcattttggtaaatttgcatctaaa
taccttacaagaacgttttactttgatgtccacccacctttaggaaaaatgttaacagcc
cttggtggatatatttttaatcaacctacagatttttcttttgcctcggcctcagaatat
ccaaaaaatttcgattttgcaggaatgagaagatttcacgcattgatatcttcactaaca
ccagtatttagttatcttattttaaaagaacttaggtacaattttacacaaagattttta
ctgtgtatgatgtttatatttgaaaatggatttacatcaataggtagattaatactacta
gattcacatcttcttacagcaacatcagctgttatttattgtcttactcgggtctttaaa
aggaatttccagaatacagatttattttttcttggtatttgtttaggattagtattaagt
ataaaatggattggatgttttacaacagcgctagtaggtatttttataatttatacttta
tggagactaattaactccaaaatgccaatcagccacgtttttctaatatttgtaaaattt
tctttatttttaattatacttccgatttctatatacatcggaatttattatatacacttt
tctatagtcaataaaacaagtacagatgaaggacatatgagctctttttttcaagcatct
ctagaaggtaattctcataaaaaaaacagaaaatatattgcttacgctactagaataaca
ttaaaaaatgcgtgtctaagtgggggatatttacattctcatcctcatatgtatcctggc
aaatcaatgaatcaagtaacaacttattcacataaagataataataacaattgggccttt
caaaaagtatcagaatcaaatactgaacctttatttgtcacagatgaagacaaggtagtg
atttaccatttagagacagcaaggtatattaatgtcagtaaaacacaatcttatttatca
caaggacttttgaccggcgcgacaactattcctttaacgaacgataacgtttttataatc
gaaacttatagcgacacacacgccaaagaaaaaagaattaaaagtctaactacaaaattt
agacttaagcactttacaacaggattgtatcttaaaagcacaaataaaaagtatcctgac
tggggattttctcaaggggaggtagtgtgtacagaagacatggatgaaggaacactttgg
actgtagaagaaaatatatctgataaggtaacaactgatataaatccattgtatgaagag
atttacaacaaattattttttaaaaactttattgaacacaatattttacaatacaacgta
aataaatcatttgttcaggatgaaaatttagagccagatgcgattgtttctaaaccttat
gaatggccaatacttagaaggggattaagaatgtgcagttgggatgaaaaatcaatgaaa
ttttacatgtttggaaatcctttactttggttttcatcaaccttaagtttattcgtagca
cctattatttttataacaaaatatattaattttaaaagaggagcaaaaaaatttaggaat
agacacaatgaggcttacgaggtatttatatgtgtaggtggatggttattacattatttg
cctttttttgcagtagggcgggttctctactttcatcattattatcccgcacttttcttt
gcaataatgtctttatgttatgtgctgcgccatttaagtattaattttgtaagggtttat
atattttatattataggattttacgctatcttttcaccattgacctatggattcatagat
tcaagaagtctaaaatttctcaagtttatcccctcatggaattttatagattaa

DBGET integrated database retrieval system