KEGG   Nosema ceranae: NCER_100513Help
Entry
NCER_100513       CDS       T01614                                 

Definition
hypothetical protein
Organism
nce  Nosema ceranae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 200 aa AA seqDB search
MGNVNSTILCEEELEELKNTSVFNFVEIEHLYERFCYLDRLNVGYLTYKELNSIPEFEMN
PFNKLICSVIERRFDYQNITFAHFLDLIGLFNIRTDLNKRIKFLFDIFDLNQDGKLCKSV
LKRIFKLMGCNDDKEVDIVLKMYDIHKKGYIDFNDFTAFYMSDPVIEQNMLIDFTKNIKQ
PSKVGFKDIIIPYFFNKKNR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgtaaacagtactattttatgcgaagaagaattagaagaattaaagaacact
agcgtatttaattttgtggaaatagaacatttgtatgaaagattctgctatttagataga
ttgaatgtaggatacttaacatacaaggaattaaatagtataccagaatttgaaatgaat
ccatttaataaattaatatgtagtgtaattgagagacgatttgattaccaaaacattact
tttgcacactttttagatcttataggattatttaatataagaacagatctgaataaaaga
attaaatttctatttgatatatttgatttaaatcaagatggtaaactttgtaaatctgtg
ctcaaaagaatatttaaattaatgggatgtaatgatgataaagaagtagatattgttctt
aaaatgtatgatatacataagaaaggatatattgattttaatgactttacggctttttac
atgagtgatcctgttattgaacagaatatgcttattgattttacaaaaaatattaaacaa
cccagcaaggtagggtttaaagatattattattccttatttttttaataagaagaatcga
tag

DBGET integrated database retrieval system