KEGG   Nosema ceranae: NCER_100601Help
Entry
NCER_100601       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
nce  Nosema ceranae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 555 aa AA seqDB search
METLKLYKFRENCCCCYSSIDCGINVCKCYLSFCDRHFNFHVRKTSCELLYRVEKNKKLK
IKNCDLSSEDMQKALERLGLILKCNNYDEKVIFKDNEVECPDLANIEFKEKISIGKLDTL
KCTDCEVSKHLYICFTCGFIGCGRIQYGIEGNGHANQHYKILGHPIFVLISSITPEYSCD
TFCYNCNEFVINPFCESKINCVEFAAPGKSWIDSQYTAKESVSNIKSPFIGIKNAGNTCF
ISSVLQLLGFIVSKENVDFNRHFKICEEQNPLNCIYCQSCKIFNKMMEQKKTLEGDNISI
VDFIKLIWSKFTIFEKNLQHDANEFLILYLDLIREGEFLGIFPNISQFFLINIENVVCCN
FCKDKKVAQEEHLVVNIPFKNTLQNSIKEHFKDHLTECTCGNEKLISNRIISLPKYLITT
VGRCKIENQRLIKIVDSLGVDEVNLLDFLKKPLLSNFFIQELVSKDFKKEEIYLALSSEI
NFKNNEDNIIKYKENHRTNPVYKIQGSIIHTGSNMNAGHYMWFALNSNTFYLVNDKKITE
EGVEYLEQSYILCLQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttaaaactttacaaatttagggaaaattgctgctgttgttattcaagcatt
gattgtggaatcaatgtttgtaaatgctatctatcattttgtgataggcattttaatttt
catgtacgtaaaacttcatgtgaacttttgtaccgagtcgaaaaaaacaaaaaattaaaa
ataaaaaactgtgatttgtcttctgaagacatgcaaaaagctttagaacgactaggttta
atattaaagtgtaataattatgatgaaaaagtgatatttaaagacaacgaagttgaatgt
cctgatttggctaatattgaatttaaagaaaaaatatctatcggtaaattagacacttta
aaatgtacagattgcgaggtatcgaaacatttatacatttgttttacatgtggatttata
ggttgtggtagaatacaatatggtattgaaggaaatggacatgcaaaccaacactataaa
atcttggggcatccaatttttgttctgatttcttctataactcctgaatattcgtgcgat
acgttttgttacaattgtaacgaatttgttattaatccattttgcgaatcaaaaataaat
tgtgtcgaatttgctgcgccaggaaaatcgtggattgacagtcaatatacagcaaaagag
tctgtatcaaatataaaatctccttttattggtattaaaaatgctggtaatacatgtttc
atttcttcagtactccaattgttaggttttatagtttctaaagaaaatgtcgattttaat
cgacattttaaaatctgtgaagaacaaaatcctttaaattgtatttactgccaatcgtgt
aaaatttttaataaaatgatggaacagaaaaaaactttagagggtgacaatatttcaata
gtagactttataaaattaatatggagtaaatttacaatttttgaaaaaaatcttcaacat
gatgctaacgaatttcttatattatatcttgatcttattcgagaaggagaatttcttggt
atttttcctaatatttctcaattttttttaattaatattgaaaatgtggtttgttgcaat
ttctgcaaagataaaaaagtggcgcaagaagaacatcttgtagtaaatattccttttaaa
aatacattgcaaaacagtataaaggagcattttaaagatcatttgacagaatgtacatgt
ggaaacgagaaattgatctctaatcgtataatttctcttcctaaatatcttattactaca
gtaggtaggtgtaaaatagagaatcaaaggttaataaaaattgtagatagtcttggagtt
gatgaagtaaatttattagattttttaaaaaaaccgttattatcgaatttttttattcaa
gaattggtttctaaagactttaaaaaagaggagatatatttagcacttagctcagaaata
aattttaaaaataacgaagataatattataaaatataaagaaaatcaccgcaccaatccc
gtttataaaatacaaggttctattatacacacaggatcgaatatgaatgctggacattac
atgtggtttgcgttaaattctaacacgttttaccttgtaaatgacaaaaaaattaccgaa
gaaggagtggaatatttagagcagtcttatattttatgtttacaataa

DBGET integrated database retrieval system