KEGG   Nosema ceranae: NCER_100616Help
Entry
NCER_100616       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
nce  Nosema ceranae
Brite
Enzymes [BR:nce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCER_100616
Transcription machinery [BR:nce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NCER_100616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MNFFEEHDEQNNKKTKELLLHENFKNNNIKLMFISNADKTTSSVLLIKLKTLFQKQLSKM
PREYILRQIFDSKHINLIILNNKDNIVGGICYRPFYDRKFFEIVFCAVDQFYQVKGVGSF
MMDILKEHTKNEIYKYTTDYKFTNQIIHDLNFYKKSYDKFIGNIFFITYADNSAVGYFKK
QGFSQNLSFDSWIGYIKDYEGGTLMECNILWDINYLNKYEIIKNKRHEFIEELKKSTSFF
KTYKIERPLFDIRSIPGVTADMRISTDKRNKENCLDGFIQLLINVLKNDPNSWPFLEPVN
AKDVPEYYEIIKSPMDLSRIKDKFHKKLYTNLDVFISDVHLMLNNCFKFNARDTQYYKCA
QALFEKFEERLKFYDESVKLWNLKN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctttgaagaacacgatgaacagaacaataaaaaaaccaaagaattactattg
cacgaaaatttcaaaaataataatattaaattgatgtttatttccaatgccgataaaaca
accagctctgtacttttaatcaaactaaaaacactttttcaaaagcagctatcaaaaatg
cctagggaatatatacttagacaaatatttgattctaaacatataaaccttattatatta
aacaataaagataacattgtagggggtatttgctacaggcctttttacgacagaaaattt
tttgaaattgtattttgtgctgtagaccaattttaccaagtaaaaggagttggaagtttt
atgatggacattttaaaagaacatacaaaaaatgaaatttataaatacaccacagattat
aaatttacaaatcaaataatacatgatctaaatttttataaaaaaagttacgataaattt
ataggtaatatattttttataacttatgcagataattctgctgtaggatattttaaaaaa
caaggatttagtcaaaatttatcatttgatagttggataggatatattaaagattatgaa
ggagggacattaatggaatgtaatatcttgtgggatattaattatttaaataagtatgaa
ataataaaaaataaaagacatgaatttattgaggaattgaaaaaatctacttcatttttc
aaaacttacaagatagaaagaccattatttgatattagatctatacctggagtcactgca
gatatgagaataagtactgataaacgtaacaaagaaaattgtttggatggatttattcaa
ttattgattaatgtattgaaaaatgatccaaactcttggccttttttagaacctgtcaat
gctaaggatgttccagaatattatgagattattaagtcaccaatggatttatcaagaata
aaagataaatttcataaaaagttgtatacaaatttagatgtttttatctcagatgtacat
ttaatgcttaataattgttttaagtttaatgctagggacacacaatattataagtgtgca
caagccctttttgaaaaatttgaggaaagactaaaattttatgatgaatctgtcaagtta
tggaatcttaaaaattaa

DBGET integrated database retrieval system