KEGG   Nosema ceranae: NCER_100628Help
Entry
NCER_100628       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
nce  Nosema ceranae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nce00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCER_100628
Enzymes [BR:nce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NCER_100628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 856 aa AA seqDB search
MFLYIFIFIVTSILILKRIITKRKKHTYTHKDHFTTKESLKYIQPTENVPYLKYTKDLKY
DIIKLNTGETINKSEMFFIEKGSVIITHEEKFVCKKQQNDFYFYALDFFGINKENVHIIA
NEPCVIWKIDKSKINTFVLLTSIKKKVIDVLVEQFDYPDLFIENELELNKLFFTDKVNRK
FQLQHFMLNILNFKKNFSMYTKVLSYTNNEVIKKKEIYMENLFLIEEGTIHLKYNDKVFY
CREGNIFGYFSLFFNCYRKIEIKCEEPVILKAISYEYLIRSGLDLQNFRLEYLKNFCTII
HYIDLCTDWRIFRINDTIANSEFCQTEAFKKIIYLNEGSLQKKDNTLIVKRLSDIIYIDE
YIIRHMLHFDINFYKKLHKKTGISKNNKIVSVLPNNNDTNIRLFSKRLKASIGKDCLLLD
KKDFFLSFDISEELRVSEFLNRLSRTHSLILINVENKFSRLAKFLHEFSDVVLVVGYGWD
INFNTTFYNDKNSETDKNFYTNVEFVKLYEQKPTQKSKPRNDNNLNCLKIHNILSPNKTI
LFSSKDYDRLSRYLMNKRIGLVLSGGGARGIAHIGVIQALEEENIPIDIIGGSSMGAFIG
ALYCKECDNGFVFLKAKQFCSRANSLLRVFLDLTFPLMSLFRGETLNNGLKKIFKNDLIQ
NLWIEYFCVTTNLFTNEEEVHISGLAWKFIRASMGLCGYVPPIIDSKGYLVDGGYLNNVP
ADIMLNMNVSKIIAVDVGTIEENDYDEHEECFNGFVGLIHKFFDVRKYITMQEIQYRLSF
LTSEKKLKALEKNNQVFVMRPELEDIHTMDFKKFDKIVATGYSSAKKILKEWKSNGIFDT
HFNQNKNKLRRRRYSV
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgtatatttttatatttattgttacatctattctcattttgaaaagaattata
accaaaagaaaaaagcatacatacacacataaagatcattttacaacgaaagaatcttta
aagtacatccagccaactgaaaatgtgccttatttgaagtatacaaaagatttaaagtat
gatattataaaacttaatacaggtgagactataaataaaagtgaaatgttttttattgaa
aaagggtcagttataatcacacatgaagaaaagtttgtttgtaaaaaacaacaaaatgat
ttttatttttatgcattagatttttttggtataaataaagaaaatgtgcatattattgca
aatgaaccgtgtgttatttggaaaatcgacaaatctaaaatcaacacatttgtattactt
actagtataaaaaagaaagtcattgatgtcttggttgaacaatttgattatccagatcta
tttatagaaaatgagttagagcttaataagctgttttttaccgacaaagtaaatcgaaaa
tttcaattacaacattttatgcttaatattttgaactttaagaaaaatttttctatgtac
acaaaagttttgagctataccaataatgaagtgattaagaaaaaagaaatatacatggaa
aatttatttttaattgaagagggaacaatacacctgaaatacaatgataaagtattttat
tgcagggaaggaaacatatttggatattttagtttattttttaattgctaccgaaaaatt
gaaattaagtgtgaagaaccagttattctaaaagcaataagctatgaatatcttataagg
agtggtcttgatctacaaaattttaggctagaatatttaaaaaatttttgtactataata
cattatattgatttatgtacagattggcgaatttttagaattaatgatactattgctaat
tcagaattttgtcaaacagaagcttttaaaaagattatttatcttaatgaaggatccttg
caaaaaaaggataatactcttattgtcaagcggcttagtgatattatttacatagatgaa
tatataatacgacatatgttacactttgatataaatttttataagaaattacataaaaaa
acaggaatctctaaaaataataaaattgttagtgttttaccaaacaacaatgatacaaat
attcgtttatttagtaaaagactcaaagcttcgattggtaaagattgtcttcttttagac
aaaaaagatttttttcttagttttgatatttctgaagaattgcgggtaagtgaattttta
aacagactttcaagaacccatagtttaattttaattaatgtagaaaataagtttagccgc
ttagctaagttcttacatgaattcagtgatgtagtcttagttgttggatatggatgggat
ataaattttaatactacattttataatgataaaaattcagagactgataaaaatttttat
actaatgtcgaatttgttaaattatacgagcaaaaaccaacacaaaaaagcaaaccccga
aatgacaataatttaaattgtcttaaaatacataacatattaagtccaaataaaacaata
ctgttttcttcaaaagactatgatagattaagcaggtatcttatgaataaaagaataggt
cttgtattaagtggtggaggagcaaggggcattgcacatattggagtaattcaggcatta
gaagaagagaatattccaattgatataattggtggaagtagtatgggggcatttataggc
gcattatattgtaaagaatgtgataatggttttgtttttttaaaagccaaacaattttgt
tctagagccaattctcttctgagagtttttctcgatttaacatttcctttaatgtcttta
tttaggggagaaacgttaaacaatggattaaaaaagatttttaaaaatgatttaatacaa
aatttatggattgaatatttttgtgtaactacaaacctgtttaccaacgaagaagaagta
catatttctggacttgcttggaaatttattagagctagtatgggtttatgtggctatgtt
ccacccatcattgattctaaaggatatcttgttgatggtgggtatcttaataatgttccg
gcagatataatgctaaatatgaatgttagcaaaattattgccgttgatgttggaaccatt
gaagaaaatgattatgacgaacatgaagaatgttttaatggatttgttggtttaatacat
aaattttttgatgttcgtaaatatataacaatgcaagaaattcaatacagactgtcattt
ttaacatctgaaaaaaagcttaaagcactagaaaagaacaatcaagtatttgtgatgaga
cccgagctagaggatattcacacgatggattttaaaaaatttgataaaattgtagcaacg
ggatattcttctgctaaaaaaattttgaaagaatggaaatcaaatggaatatttgatacg
cactttaatcagaataaaaataaacttcgaaggcgcagatattctgtataa

DBGET integrated database retrieval system