KEGG   Nosema ceranae: NCER_100663Help
Entry
NCER_100663       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nce  Nosema ceranae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NCER_100663
   00052 Galactose metabolism
    NCER_100663
   00500 Starch and sucrose metabolism
    NCER_100663
   00520 Amino sugar and nucleotide sugar metabolism
    NCER_100663
Enzymes [BR:nce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NCER_100663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 478 aa AA seqDB search
MEEADSNEYSIFIDNICIDNLLKRMKKNLEKMEGECDKKELSQFYEIYERYLKTRGETLK
WDDIKHPKDRIIQYDDIVEQNVDPKNLLGKLAVLKLNGGLGTTMGCIGPKSAIPVKSGKN
FIDLVVKQLKFLRRKYNVEVPLVLMNSFNTESMTETLISRHDNILTFNQSKYPRISSDTL
LPPNNLKKEEMFYPPGHGDIFNSLDASGMLDKLLGEGKEYLFISNIDNLAATVDLNLLEY
FASQQLEFMMEVTSKTRADIKGGTLIEYGGALRLLEIAQVPLSKKSEFTSVRKFKIFNTN
SAWINLKALKEKLKTETFPLDIIENKKTAGRETVFQLETAIGSAIRFFKKSCGVVVPRSR
FLPVKSCSDLFLVESNLFVERNGQLILNPQRVPMCVPTIKLIGENFKKIDRYEDSFKGIP
DLLELDSLTVSGNVKFGKNVVLKGTVIILADKNSVINIPDGSVLDDNIVYGNLPIIEH
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagctgatagtaatgaatattcaatttttatagataacatatgtattgataat
cttcttaaaagaatgaaaaagaatcttgagaagatggaaggcgagtgtgacaaaaaagaa
ctgtcacagttttacgaaatttatgaaaggtatttaaaaacgcgaggcgaaacactaaaa
tgggatgatatcaagcatcctaaagatcgaattattcaatatgacgatattgttgagcaa
aacgtagatccaaaaaatcttcttggaaaattagcagttttaaaacttaatggtggtcta
ggtactacaatggggtgtattggacctaaaagtgctataccagtcaaaagtggtaaaaat
ttcattgatttagttgttaaacaactaaaatttttgaggcgaaaatacaatgttgaggtg
ccgctagtgcttatgaactcatttaatactgaaagtatgactgaaacactaatatccaga
catgacaatattttaacctttaaccagtcaaaatatcctaggattagttcagacacctta
ttacctcctaataacttaaaaaaggaggagatgttttatccacctggccacggtgatata
tttaactcattagatgctagtggaatgttagataaattacttggtgaaggcaaagaatat
ctttttatatcaaatatagataatttggctgctactgttgatcttaatctcctagaatat
tttgcatcgcaacaattggaatttatgatggaagttacatcaaaaacaagagcagacatt
aaagggggaactttaatagaatatggaggtgcattaagactgttagaaattgcacaggtc
ccattgtctaaaaaatcggagttcacaagtgtaagaaaatttaagatatttaatacaaat
tctgcttggataaatcttaaagccttaaaggaaaaattaaaaaccgaaacatttccgctt
gacattattgaaaataaaaaaacagcaggaagagaaactgtttttcaattggaaacagca
attggttcggcaataagattttttaaaaaatcgtgcggtgtagtagttccaagatcaaga
tttttacctgtaaaatcatgttctgatttatttttagtagaaagtaatctatttgtcgaa
cgaaacggacaactcattttaaatccacagcgcgtaccaatgtgtgtgccaaccataaag
cttattggcgaaaatttcaaaaaaatagatcgttatgaagattcttttaaggggatacct
gatttattagagcttgatagtcttacagtatcgggaaatgttaaatttggtaaaaatgtt
gtattaaaaggtactgtgattattttagcagataaaaatagtgttataaatattcctgac
ggaagtgttttagatgataacatagtatatggaaaccttcctattatagaacattaa

DBGET integrated database retrieval system