KEGG   Nosema ceranae: NCER_100663Help
Entry
NCER_100663       CDS       T01614                                 

Definition
(GenBank) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nce  Nosema ceranae
Pathway
nce00040  Pentose and glucuronate interconversions
nce00052  Galactose metabolism
nce00500  Starch and sucrose metabolism
nce00520  Amino sugar and nucleotide sugar metabolism
nce01100  Metabolic pathways
nce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NCER_100663
   00052 Galactose metabolism
    NCER_100663
   00500 Starch and sucrose metabolism
    NCER_100663
   00520 Amino sugar and nucleotide sugar metabolism
    NCER_100663
Enzymes [BR:nce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NCER_100663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP DUF2507
Motif
Other DBs
NCBI-ProteinID: EEQ82591
UniProt: C4V858
AA seq 478 aa AA seqDB search
MEEADSNEYSIFIDNICIDNLLKRMKKNLEKMEGECDKKELSQFYEIYERYLKTRGETLK
WDDIKHPKDRIIQYDDIVEQNVDPKNLLGKLAVLKLNGGLGTTMGCIGPKSAIPVKSGKN
FIDLVVKQLKFLRRKYNVEVPLVLMNSFNTESMTETLISRHDNILTFNQSKYPRISSDTL
LPPNNLKKEEMFYPPGHGDIFNSLDASGMLDKLLGEGKEYLFISNIDNLAATVDLNLLEY
FASQQLEFMMEVTSKTRADIKGGTLIEYGGALRLLEIAQVPLSKKSEFTSVRKFKIFNTN
SAWINLKALKEKLKTETFPLDIIENKKTAGRETVFQLETAIGSAIRFFKKSCGVVVPRSR
FLPVKSCSDLFLVESNLFVERNGQLILNPQRVPMCVPTIKLIGENFKKIDRYEDSFKGIP
DLLELDSLTVSGNVKFGKNVVLKGTVIILADKNSVINIPDGSVLDDNIVYGNLPIIEH
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagctgatagtaatgaatattcaatttttatagataacatatgtattgataat
cttcttaaaagaatgaaaaagaatcttgagaagatggaaggcgagtgtgacaaaaaagaa
ctgtcacagttttacgaaatttatgaaaggtatttaaaaacgcgaggcgaaacactaaaa
tgggatgatatcaagcatcctaaagatcgaattattcaatatgacgatattgttgagcaa
aacgtagatccaaaaaatcttcttggaaaattagcagttttaaaacttaatggtggtcta
ggtactacaatggggtgtattggacctaaaagtgctataccagtcaaaagtggtaaaaat
ttcattgatttagttgttaaacaactaaaatttttgaggcgaaaatacaatgttgaggtg
ccgctagtgcttatgaactcatttaatactgaaagtatgactgaaacactaatatccaga
catgacaatattttaacctttaaccagtcaaaatatcctaggattagttcagacacctta
ttacctcctaataacttaaaaaaggaggagatgttttatccacctggccacggtgatata
tttaactcattagatgctagtggaatgttagataaattacttggtgaaggcaaagaatat
ctttttatatcaaatatagataatttggctgctactgttgatcttaatctcctagaatat
tttgcatcgcaacaattggaatttatgatggaagttacatcaaaaacaagagcagacatt
aaagggggaactttaatagaatatggaggtgcattaagactgttagaaattgcacaggtc
ccattgtctaaaaaatcggagttcacaagtgtaagaaaatttaagatatttaatacaaat
tctgcttggataaatcttaaagccttaaaggaaaaattaaaaaccgaaacatttccgctt
gacattattgaaaataaaaaaacagcaggaagagaaactgtttttcaattggaaacagca
attggttcggcaataagattttttaaaaaatcgtgcggtgtagtagttccaagatcaaga
tttttacctgtaaaatcatgttctgatttatttttagtagaaagtaatctatttgtcgaa
cgaaacggacaactcattttaaatccacagcgcgtaccaatgtgtgtgccaaccataaag
cttattggcgaaaatttcaaaaaaatagatcgttatgaagattcttttaaggggatacct
gatttattagagcttgatagtcttacagtatcgggaaatgttaaatttggtaaaaatgtt
gtattaaaaggtactgtgattattttagcagataaaaatagtgttataaatattcctgac
ggaagtgttttagatgataacatagtatatggaaaccttcctattatagaacattaa

DBGET integrated database retrieval system