KEGG   Nosema ceranae: NCER_100663Help
Entry
NCER_100663       CDS       T01614                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nce  Nosema ceranae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NCER_100663
   00052 Galactose metabolism
    NCER_100663
   00500 Starch and sucrose metabolism
    NCER_100663
   00520 Amino sugar and nucleotide sugar metabolism
    NCER_100663
Enzymes [BR:nce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NCER_100663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 478 aa AA seqDB search
MEEADSNEYSIFIDNICIDNLLKRMKKNLEKMEGECDKKELSQFYEIYERYLKTRGETLK
WDDIKHPKDRIIQYDDIVEQNVDPKNLLGKLAVLKLNGGLGTTMGCIGPKSAIPVKSGKN
FIDLVVKQLKFLRRKYNVEVPLVLMNSFNTESMTETLISRHDNILTFNQSKYPRISSDTL
LPPNNLKKEEMFYPPGHGDIFNSLDASGMLDKLLGEGKEYLFISNIDNLAATVDLNLLEY
FASQQLEFMMEVTSKTRADIKGGTLIEYGGALRLLEIAQVPLSKKSEFTSVRKFKIFNTN
SAWINLKALKEKLKTETFPLDIIENKKTAGRETVFQLETAIGSAIRFFKKSCGVVVPRSR
FLPVKSCSDLFLVESNLFVERNGQLILNPQRVPMCVPTIKLIGENFKKIDRYEDSFKGIP
DLLELDSLTVSGNVKFGKNVVLKGTVIILADKNSVINIPDGSVLDDNIVYGNLPIIEH
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagctgatagtaatgaatattcaatttttatagataacatatgtattgataat
cttcttaaaagaatgaaaaagaatcttgagaagatggaaggcgagtgtgacaaaaaagaa
ctgtcacagttttacgaaatttatgaaaggtatttaaaaacgcgaggcgaaacactaaaa
tgggatgatatcaagcatcctaaagatcgaattattcaatatgacgatattgttgagcaa
aacgtagatccaaaaaatcttcttggaaaattagcagttttaaaacttaatggtggtcta
ggtactacaatggggtgtattggacctaaaagtgctataccagtcaaaagtggtaaaaat
ttcattgatttagttgttaaacaactaaaatttttgaggcgaaaatacaatgttgaggtg
ccgctagtgcttatgaactcatttaatactgaaagtatgactgaaacactaatatccaga
catgacaatattttaacctttaaccagtcaaaatatcctaggattagttcagacacctta
ttacctcctaataacttaaaaaaggaggagatgttttatccacctggccacggtgatata
tttaactcattagatgctagtggaatgttagataaattacttggtgaaggcaaagaatat
ctttttatatcaaatatagataatttggctgctactgttgatcttaatctcctagaatat
tttgcatcgcaacaattggaatttatgatggaagttacatcaaaaacaagagcagacatt
aaagggggaactttaatagaatatggaggtgcattaagactgttagaaattgcacaggtc
ccattgtctaaaaaatcggagttcacaagtgtaagaaaatttaagatatttaatacaaat
tctgcttggataaatcttaaagccttaaaggaaaaattaaaaaccgaaacatttccgctt
gacattattgaaaataaaaaaacagcaggaagagaaactgtttttcaattggaaacagca
attggttcggcaataagattttttaaaaaatcgtgcggtgtagtagttccaagatcaaga
tttttacctgtaaaatcatgttctgatttatttttagtagaaagtaatctatttgtcgaa
cgaaacggacaactcattttaaatccacagcgcgtaccaatgtgtgtgccaaccataaag
cttattggcgaaaatttcaaaaaaatagatcgttatgaagattcttttaaggggatacct
gatttattagagcttgatagtcttacagtatcgggaaatgttaaatttggtaaaaatgtt
gtattaaaaggtactgtgattattttagcagataaaaatagtgttataaatattcctgac
ggaagtgttttagatgataacatagtatatggaaaccttcctattatagaacattaa

DBGET integrated database retrieval system