KEGG   Nosema ceranae: NCER_100811Help
Entry
NCER_100811       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
nce  Nosema ceranae
Brite
Exosome [BR:nce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NCER_100811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 137 aa AA seqDB search
MNKAPKQNTGKAPISTTQVGDLDKKKKKKMSNLCSGMQFKSAIKKIAKDINPDQTVFLTS
QAIAILCAIAYDIVSTCGEVASEFSKKVSKQTVGADEIVAAFEILLKGELKKLALREVHT
CLSKPSAPSKPSKSLKD
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcaccaaaacaaaatacaggtaaagcgccaataagtactacacaagtcgga
gatctggacaaaaaaaagaagaagaaaatgtctaatttatgttctggtatgcaattcaaa
tctgcaataaaaaagattgccaaggatattaatcctgatcaaacagtatttttaactagt
caggccattgctattttatgtgctattgcttatgatattgtttctacttgtggtgaagta
gcctctgagttttctaagaaagtaagtaaacagactgttggtgccgatgaaattgtggcc
gcatttgaaattttattaaaaggagaattaaagaaattagcattaagagaagtacacact
tgtttgtccaagccaagtgcaccatctaagccttctaaatcccttaaagattaa

DBGET integrated database retrieval system