KEGG   Nosema ceranae: NCER_100896Help
Entry
NCER_100896       CDS       T01614                                 

Definition
(GenBank) hypothetical protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
nce  Nosema ceranae
Brite
Enzymes [BR:nce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCER_100896
Transfer RNA biogenesis [BR:nce03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NCER_100896
Chromosome and associated proteins [BR:nce03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    NCER_100896
   HAT complexes
    Elongator complex
     NCER_100896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: EEQ82395
UniProt: C4V8Q8
AA seq 559 aa AA seqDB search
MSNFLLACNEIANEIIKLYKQDKKINVSNITSIMCKKYKLKSTPRIVDIISSIPYDYKDL
ISKLKAKPVRTASGVAVVAVMCKPHRCPHIALTGNICIYCPGGPDSEFEYSTQSYTGYEP
TSMRAIRSRYDPYDQARERLKQLKSLGHNIDKVEYIIMGGTFMSLSETYKNEFIIKLHDA
LSGHKSNTVEEAVSVGAESKQKCVGITIETRPDYCAKSHLDKMLAYGCTRIEIGVQSVYE
DVARDTNRGHTVEAVCQSFCMTKDAGYKIVSHMMPNLPNVGWKRDLAQFREYFDNPRFRS
DGLKIYPTLVIRGTGLYELWRNNQYKNYSPDELIDFLARILSFVPPWTRIYRVQRDIPMT
LVSSGVEHGNIRELALLRMKDYKTKCRDVRTREIGIKDIHEKLDTINPELVRRDYVANKG
SETFLSYEDVKQDVLIGLLRLRKCSEETYRAELKGVNDKNIYDVINPDFEIIFNKAINNN
NASIIRELHVYGSAVSLDQKDNSKFQHKGYGKLLIDEAERIAREEHNSNKMAIISGVGTR
KYYEKFGYHLEGPYMVKML
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaattttttactggcatgtaacgagattgcaaatgaaataataaagttgtataaa
caagataaaaaaataaatgtcagtaatataacatcgattatgtgtaaaaaatataagctt
aaaagtactcctagaattgtggatattatttctagtattccttatgattacaaagattta
atttcaaaactcaaagctaaaccagtacggacagcttctggtgttgcggtagtagcagta
atgtgcaagccacatagatgtccacatatagcactgactggaaacatttgtatatattgt
cctggagggcccgattctgagtttgaatattctacacaatcttatacagggtatgaacca
acaagtatgagggctattagaagccgctacgatccttatgatcaagcacgcgagagatta
aaacaattgaagagtttaggacacaatatagataaggttgaatatataattatgggagga
acatttatgtcgttatctgaaacatacaaaaatgaatttataattaaattacatgatgca
cttagtggacacaaatctaatactgttgaagaggcagtatctgttggagccgagtcaaaa
cagaaatgtgtaggtattacaatagaaacgaggcctgattattgtgctaaatctcattta
gataaaatgttggcatacggttgtactaggattgaaattggtgtacaaagtgtatatgaa
gatgttgccagggatacaaataggggacacacagttgaggctgtttgtcaatctttttgt
atgactaaagacgctgggtataaaattgttagtcatatgatgcctaatttgcctaatgtt
ggatggaaacgtgacttagcacagtttagagaatattttgataatccgcgttttagaagt
gacggattaaaaatttatccaactttagttattagaggtacggggttgtatgagctatgg
agaaataatcaatataaaaattattctcctgatgaacttatcgattttttagctagaatt
ttatcttttgttccaccatggacaagaatctatagagttcaacgtgatatacctatgact
ttggttagctcaggtgtagagcacggaaatataagagagttagcacttttgcgaatgaag
gattataaaactaaatgtcgtgatgtaagaacaagagaaattggcattaaagacattcat
gagaagcttgatacaattaatcctgaacttgttaggcgtgattatgtcgccaataaaggc
agtgaaacatttcttagttatgaagatgtcaagcaggatgttttaattggtcttttacgg
ttaagaaaatgtagcgaagaaacttatagggctgagttaaaaggtgttaatgacaaaaat
atttatgacgtcattaatcctgattttgagattatatttaataaagctatcaacaataat
aatgcttctattattagagagttgcatgtttatggaagtgctgttagtcttgaccagaaa
gacaattcaaaatttcagcacaaaggatacggaaaattattaattgatgaagcggaaaga
attgcccgcgaagagcataattcgaacaaaatggctattatttctggcgttggtacaaga
aaatattacgaaaaatttggatatcatttagaaggaccatatatggtaaaaatgctataa

DBGET integrated database retrieval system