KEGG   Nosema ceranae: NCER_100934Help
Entry
NCER_100934       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
nce  Nosema ceranae
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:nce00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NCER_100934
  Replication and repair
   03420 Nucleotide excision repair
    NCER_100934
Transcription machinery [BR:nce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NCER_100934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 403 aa AA seqDB search
MVDLNIIIDYIRQLKLIHKQHLYNSPVLATSIIKIFDDSTIRLIYDLLLTAPSIKSLQKN
EEIKNSLKTLLKISLIYKKGTNIFIDNIFRNAFLTGIELNNLNEYYEILEPIKCTVSKNT
KFEEILKFLVTKNNVNHAPGVVNVLKFSNLIDNNYDITNKGFEFLLKPRYDQYWFLIIAA
LKFYCVDEILQISNFMSIMELSNMLPIYKYKLKKDVNKKFYDFLSYLGLIKLENDILTIY
HNLFVKSDTKKLRFILLETNFKLYAYTSSVYEMSIIQLFSNIYLKMPNLIKASITEESLS
NAFSKGVTSQQIINFLKSYSLFEDIPVAIISQIIIWETKRKRIKIFPGYLYSNFLNLIDY
QKVVKFCLSNDCIIEKDDEKRMIVIKPDHNEVVKKFVKQQINK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggtagacttaaatataataatagattacattagacagttaaaattaatacacaaacaa
catttatacaattcaccagtattggcaacatctattataaaaatatttgatgattctacc
attcgtcttatatacgatcttttacttactgcaccatcaatcaaatcactacaaaaaaat
gaagagataaaaaattcgttaaaaactttacttaaaatatctttaatttataaaaaaggt
actaatatttttattgataacatttttagaaatgcatttcttacaggaatagaacttaat
aatttgaatgaatactatgaaatattagaacctataaaatgtacggtaagtaaaaataca
aaatttgaagaaatactaaaatttcttgttactaaaaataatgttaatcacgcacctggt
gtagtaaatgtactaaagtttagtaatctaatagataataattatgatataacaaataaa
ggctttgaattcttactaaagccaagatatgaccaatactggtttttaattattgctgca
ttaaaattttattgtgtagacgaaatactacaaatatcaaattttatgagtattatggag
ctatcaaatatgttgccgatttacaaatacaaactaaaaaaagatgtaaacaaaaaattt
tatgattttttaagttatttaggattaattaaattggaaaatgatatattgacaatatat
cacaatttgtttgttaaaagtgatactaaaaaattaagatttattttattagaaacaaat
tttaagttgtatgcatatacatcatctgtgtatgaaatgtctattatccaattattttct
aatatttatttaaaaatgccaaatttaattaaagctagtataactgaagagagtttatct
aatgcattttctaaaggtgttacaagtcaacagattataaatttcttaaaatcttattct
ctttttgaagacattcctgtagcaataattagtcaaattattatatgggagacaaaacgt
aagcgtataaaaatattccctggatatttatattccaatttcttaaatttaatagattat
caaaaagtagtaaaattctgtttatccaacgattgtattattgagaaagatgatgaaaaa
agaatgattgtaattaaacctgatcacaatgaagtagtaaaaaagtttgttaagcagcaa
attaataaataa

DBGET integrated database retrieval system