KEGG   Nosema ceranae: NCER_100934Help
Entry
NCER_100934       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
nce  Nosema ceranae
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:nce03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:nce03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 403 aa AA seqDB search
MVDLNIIIDYIRQLKLIHKQHLYNSPVLATSIIKIFDDSTIRLIYDLLLTAPSIKSLQKN
EEIKNSLKTLLKISLIYKKGTNIFIDNIFRNAFLTGIELNNLNEYYEILEPIKCTVSKNT
KFEEILKFLVTKNNVNHAPGVVNVLKFSNLIDNNYDITNKGFEFLLKPRYDQYWFLIIAA
LKFYCVDEILQISNFMSIMELSNMLPIYKYKLKKDVNKKFYDFLSYLGLIKLENDILTIY
HNLFVKSDTKKLRFILLETNFKLYAYTSSVYEMSIIQLFSNIYLKMPNLIKASITEESLS
NAFSKGVTSQQIINFLKSYSLFEDIPVAIISQIIIWETKRKRIKIFPGYLYSNFLNLIDY
QKVVKFCLSNDCIIEKDDEKRMIVIKPDHNEVVKKFVKQQINK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggtagacttaaatataataatagattacattagacagttaaaattaatacacaaacaa
catttatacaattcaccagtattggcaacatctattataaaaatatttgatgattctacc
attcgtcttatatacgatcttttacttactgcaccatcaatcaaatcactacaaaaaaat
gaagagataaaaaattcgttaaaaactttacttaaaatatctttaatttataaaaaaggt
actaatatttttattgataacatttttagaaatgcatttcttacaggaatagaacttaat
aatttgaatgaatactatgaaatattagaacctataaaatgtacggtaagtaaaaataca
aaatttgaagaaatactaaaatttcttgttactaaaaataatgttaatcacgcacctggt
gtagtaaatgtactaaagtttagtaatctaatagataataattatgatataacaaataaa
ggctttgaattcttactaaagccaagatatgaccaatactggtttttaattattgctgca
ttaaaattttattgtgtagacgaaatactacaaatatcaaattttatgagtattatggag
ctatcaaatatgttgccgatttacaaatacaaactaaaaaaagatgtaaacaaaaaattt
tatgattttttaagttatttaggattaattaaattggaaaatgatatattgacaatatat
cacaatttgtttgttaaaagtgatactaaaaaattaagatttattttattagaaacaaat
tttaagttgtatgcatatacatcatctgtgtatgaaatgtctattatccaattattttct
aatatttatttaaaaatgccaaatttaattaaagctagtataactgaagagagtttatct
aatgcattttctaaaggtgttacaagtcaacagattataaatttcttaaaatcttattct
ctttttgaagacattcctgtagcaataattagtcaaattattatatgggagacaaaacgt
aagcgtataaaaatattccctggatatttatattccaatttcttaaatttaatagattat
caaaaagtagtaaaattctgtttatccaacgattgtattattgagaaagatgatgaaaaa
agaatgattgtaattaaacctgatcacaatgaagtagtaaaaaagtttgttaagcagcaa
attaataaataa

DBGET integrated database retrieval system