KEGG   Nosema ceranae: NCER_100966Help
Entry
NCER_100966       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
nce  Nosema ceranae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NCER_100966
   03420 Nucleotide excision repair
    NCER_100966
   03430 Mismatch repair
    NCER_100966
   03440 Homologous recombination
    NCER_100966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 218 aa AA seqDB search
MSDLGYNPSSPKKEYTGIKTIRSLTIKQVLSAEHEDGSTVIYVDNKELSTLKIIGWVYSV
KSTNSGKTFIVEDGTGEIECMLWANRAYEEYMASFIEDGILVRIVGTLKEFLGKKNITVS
NIYVVEDYNELLYHMITAVKDHLSKKEILNKEDMHKIHRDILECIRNNQDDDTGLDIKII
IKCLQNEYNERMIRESLEYLVDNCHLVITNDDGYKTVN
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatctcggttataatccttcatcacctaaaaaagaatacactggtataaaaact
ataagatctcttacaatcaaacaagtattatctgccgaacacgaagatggttctacagta
atctatgtagacaataaagaacttagtacactaaaaattattggatgggtgtacagtgta
aaaagtactaacagtggtaaaacttttattgttgaagacggaactggagaaattgaatgc
atgttatgggctaatagggcctatgaagaatatatggccagttttattgaggatggaata
ctggtcagaattgtaggcacacttaaagaatttttgggaaaaaaaaatattactgtttct
aacatttatgttgtagaagattacaatgaattattgtatcacatgattactgcagtaaaa
gatcatttatctaaaaaagaaatattaaataaagaagatatgcataaaatacacagagat
atattagaatgtataaggaacaatcaagatgatgacactggtttagatataaaaattatt
attaaatgtttacaaaatgaatacaacgagagaatgataagagaaagtttagaatatttg
gtagataattgtcatctagttattacaaatgatgatggatataaaactgttaattaa

DBGET integrated database retrieval system