KEGG   Nosema ceranae: NCER_100991Help
Entry
NCER_100991       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
nce  Nosema ceranae
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:nce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCER_100991
Translation factors [BR:nce03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NCER_100991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 182 aa AA seqDB search
MKLNIKKKNEDIILCDTNYVVTYKEIDDTEINKETYNKDLEIICEIESINNLVYFLERLK
AFETVRDCYINVFKEGIQPLWEDENNKNGCNWSLVLKKEICQRYFEKLIVRMCTGFFRVI
VPSGVVGVYKDNRFKLSIWSKTIPQPSEHVNAINELKSALDINFNVSFQYKKHSKLLEPR
EE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaatataaaaaagaaaaatgaagacattattttatgtgacacaaattatgtt
gtaacatataaagaaattgacgacacagaaattaataaagagacgtataataaagattta
gaaattatttgcgaaattgaaagtataaataatttggtttattttttagaaaggcttaaa
gcctttgaaacagtaagagattgttacattaatgtttttaaagaagggatacagcctctt
tgggaggatgagaataataaaaatggatgcaactggagtcttgtattaaaaaaggaaatt
tgtcaaagatattttgaaaaattaatagttagaatgtgtactggattttttagggttatt
gttccttcaggtgttgtgggagtttataaagataatagatttaagttatcaatttggtca
aaaacgattccacaaccaagtgaacatgtaaatgccataaatgaacttaagagtgcttta
gatattaattttaatgtgtcatttcagtataaaaagcatagtaaattactagaacctaga
gaagaataa

DBGET integrated database retrieval system