KEGG   Nosema ceranae: NCER_101010Help
Entry
NCER_101010       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
nce  Nosema ceranae
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:nce04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:nce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:nce04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 476 aa AA seqDB search
MYEDVKLHILKSFKYANYDNMAFLSSFLYSNASNQYKLLLPISLYYTGEYNRSLFLLSSL
NTVTSVYYKYLCYNKLKDYKKALICLTKIITDDVDEDDLDLDIFLVNKEDKEYFYNDMAL
LLTQLYDRDEAIRYFKMSYNIYPIFTTIENLIYENILTTFDHQDILIRNKENIKKTNLVS
TSSLHELISDLNKNEQNIEKYKNFIPGIGSYVVAFYAKSLFELGLIDESRRLFYILRSKD
PKFMYNMDYFSTILWYSQDVTELGILCKNMIIDSPSSSVTWKALGNYYNHINDYKRSFLC
LKRSSYILNEPYTLNLLGFESVYKNEYTEALDYFKKSNLMLKNNYKSMYGCALVYDKMDN
KSTADFYFRKCMYNNQLKAMGMKFYIKHGELDIALQIYKDAMKFDSSDINILVQQTLIKR
GTFTNVEEFLILEFVEILTKLNLFEFAKNILNIIEYRGETYYKKKEMVYEKRHEFI
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaagatgtaaagttacacattctcaaatcttttaaatatgcgaactatgacaac
atggcttttttatcatctttcttatattcaaatgcaagtaatcaatacaaattattactt
cccatatcattgtattacacaggagaatataacaggtctttatttttactttcttcttta
aatacagtaacttctgtttattataaatatttatgttacaataagcttaaagattataaa
aaggcattaatatgtttaacaaaaattattacagatgatgttgatgaagatgaccttgac
ttggatatttttctagttaataaagaagataaagaatatttttacaacgacatggcatta
ttacttactcaattatatgatagagatgaagctataagatattttaaaatgagctataat
atttatccgatatttacaactattgaaaatttaatttatgaaaatattttaacaacattt
gatcatcaagatattttaattagaaataaagaaaatattaaaaagacaaatttagtcagt
acatcaagtcttcatgagcttatctctgatttaaataaaaatgaacaaaatattgaaaaa
tataaaaactttattcctggcataggatcatatgttgttgcattttatgcaaaaagtctt
tttgagttaggactcattgatgaaagtcgaaggttgttttatattttgcgttctaaagat
ccgaaatttatgtataatatggattattttagtacaattttatggtattcacaggatgtt
acagaattaggtatattgtgtaaaaacatgataatagattcacctagcagttctgtgaca
tggaaagctttgggtaattattataatcacattaatgattataaaagaagctttttgtgt
ttaaaaagaagttcttatattttaaatgaaccttatacattaaatttattaggatttgaa
agtgtatacaaaaatgaatacaccgaagctttagattattttaaaaaaagtaatttgatg
ttaaaaaacaactataaatctatgtatggatgtgcacttgtttatgataaaatggataat
aaatctacagccgatttttattttagaaaatgtatgtataacaatcaacttaaagccatg
ggaatgaagttctacattaaacatggagaacttgatattgcacttcagatttacaaagat
gccatgaagtttgattcatcagatatcaatatacttgtacaacaaacattaattaaaagg
gggacttttacaaatgtcgaagagtttttaattttagaatttgtggaaattctaacaaaa
ttaaatttgtttgaatttgcaaaaaatatactgaatattatcgaataccgtggtgaaaca
tattataaaaaaaaagaaatggtatatgaaaaaagacatgaatttatataa

DBGET integrated database retrieval system