KEGG   Nosema ceranae: NCER_101010Help
Entry
NCER_101010       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
nce  Nosema ceranae
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:nce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NCER_101010
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NCER_101010
   04113 Meiosis - yeast
    NCER_101010
Protein phosphatases and associated proteins [BR:nce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NCER_101010
Ubiquitin system [BR:nce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     NCER_101010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 476 aa AA seqDB search
MYEDVKLHILKSFKYANYDNMAFLSSFLYSNASNQYKLLLPISLYYTGEYNRSLFLLSSL
NTVTSVYYKYLCYNKLKDYKKALICLTKIITDDVDEDDLDLDIFLVNKEDKEYFYNDMAL
LLTQLYDRDEAIRYFKMSYNIYPIFTTIENLIYENILTTFDHQDILIRNKENIKKTNLVS
TSSLHELISDLNKNEQNIEKYKNFIPGIGSYVVAFYAKSLFELGLIDESRRLFYILRSKD
PKFMYNMDYFSTILWYSQDVTELGILCKNMIIDSPSSSVTWKALGNYYNHINDYKRSFLC
LKRSSYILNEPYTLNLLGFESVYKNEYTEALDYFKKSNLMLKNNYKSMYGCALVYDKMDN
KSTADFYFRKCMYNNQLKAMGMKFYIKHGELDIALQIYKDAMKFDSSDINILVQQTLIKR
GTFTNVEEFLILEFVEILTKLNLFEFAKNILNIIEYRGETYYKKKEMVYEKRHEFI
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaagatgtaaagttacacattctcaaatcttttaaatatgcgaactatgacaac
atggcttttttatcatctttcttatattcaaatgcaagtaatcaatacaaattattactt
cccatatcattgtattacacaggagaatataacaggtctttatttttactttcttcttta
aatacagtaacttctgtttattataaatatttatgttacaataagcttaaagattataaa
aaggcattaatatgtttaacaaaaattattacagatgatgttgatgaagatgaccttgac
ttggatatttttctagttaataaagaagataaagaatatttttacaacgacatggcatta
ttacttactcaattatatgatagagatgaagctataagatattttaaaatgagctataat
atttatccgatatttacaactattgaaaatttaatttatgaaaatattttaacaacattt
gatcatcaagatattttaattagaaataaagaaaatattaaaaagacaaatttagtcagt
acatcaagtcttcatgagcttatctctgatttaaataaaaatgaacaaaatattgaaaaa
tataaaaactttattcctggcataggatcatatgttgttgcattttatgcaaaaagtctt
tttgagttaggactcattgatgaaagtcgaaggttgttttatattttgcgttctaaagat
ccgaaatttatgtataatatggattattttagtacaattttatggtattcacaggatgtt
acagaattaggtatattgtgtaaaaacatgataatagattcacctagcagttctgtgaca
tggaaagctttgggtaattattataatcacattaatgattataaaagaagctttttgtgt
ttaaaaagaagttcttatattttaaatgaaccttatacattaaatttattaggatttgaa
agtgtatacaaaaatgaatacaccgaagctttagattattttaaaaaaagtaatttgatg
ttaaaaaacaactataaatctatgtatggatgtgcacttgtttatgataaaatggataat
aaatctacagccgatttttattttagaaaatgtatgtataacaatcaacttaaagccatg
ggaatgaagttctacattaaacatggagaacttgatattgcacttcagatttacaaagat
gccatgaagtttgattcatcagatatcaatatacttgtacaacaaacattaattaaaagg
gggacttttacaaatgtcgaagagtttttaattttagaatttgtggaaattctaacaaaa
ttaaatttgtttgaatttgcaaaaaatatactgaatattatcgaataccgtggtgaaaca
tattataaaaaaaaagaaatggtatatgaaaaaagacatgaatttatataa

DBGET integrated database retrieval system