KEGG   Nosema ceranae: NCER_101148Help
Entry
NCER_101148       CDS       T01614                                 

Definition
(RefSeq) hypothetical protein
Organism
nce  Nosema ceranae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 862 aa AA seqDB search
MKRKIIRENKCKEEVNVEIIEEKSKQTIKFINYKLYSNHVKYFTDDTLLLYLDFEYNKTN
LDDFYVRYYIFDKLQEKNNTLETFCKQKQMLYILAQQKFRYFLETFLSKNRCFEKMICLE
SYPFRVEKLLEEYDINFFLKKRTNFLEEKNECLPKLIGQSTFYDFSTNTKNINNLNLLCL
KPPINMLLTKEQNSDSETEYLDASEETNKIKTNIFKIKNEIKKADIKEYNKEMLFFIDKC
IECKNNITEISLDINLCPITYNVNLGSRIYNLMKVDHESDFTIFEVLQSLCYLTDDLQTF
MKSYKVLQINGIIIHPLTKVKELSPIDKYVIVTNISNIDLGIDSKINKNRNILGFKNLGN
TCFMNASLQAIINCKEFSDYFYSCDLDRLGNHKIVSAAFSELIKMFDKNLEYLIPSKLKY
VIGSKVDIYNEKDEQDSMEFVFDLLNLVHEELKLKKKSKLENIDSYKKWQIENQSIVTSL
FFSKIKSSIVCAMCSNERFIFEPCLSLSVPVPLEKKYFSNIVIFYESYNRVPLKIFAEET
LTIFELKILLCEEYNVTHKILCCQIMNNTIKVIDDFQQLKCLKSTLFCYEFIQENVEEYI
WISIDRKYFFWTIPFDFLILGRIPKNCNKEDEKTYKQNIIDIVRYRLVPFIDQKNINMLY
GSFNDIFYIKHKKIQSSSKSILNRSQCFLQISNANYISLFGPNFQPINNMIHLVSDKIDL
INCLNLFLEKEYIFGDDKQFCKKCNQHTIHYKDTDLDLLPKYLIIQLKRFRFNGVDFEKI
GTFVDFEMGVFYIKKCKYKIISIINHISPSGGYAFRSVGSNGHYTAYIRHQNDWFHCNDH
IITKVSEVKKDDAYIFILEKIE
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaagatcattagggaaaataaatgtaaagaagaagtaaatgtggaaattatt
gaagaaaaatcgaaacagacaatcaaatttataaattataaactgtattccaatcatgta
aaatattttactgatgatactttattgttgtatttagactttgaatataataaaactaat
ttagatgatttttatgtaagatactatatatttgacaaattgcaggagaaaaacaataca
cttgaaacattttgtaaacaaaaacaaatgttatatatattagcacaacaaaagtttaga
tattttttagaaacctttttatcaaaaaatcgctgttttgagaaaatgatttgtttagaa
tcttatccttttagagttgaaaaattattggaagaatatgacattaatttttttttaaag
aaaagaacaaattttttagaagaaaaaaatgaatgtttaccaaaattaatagggcaaagc
acattttatgatttctcgacaaatacaaaaaacataaataatttaaatttgttgtgtctt
aaaccaccaattaacatgcttttaacaaaagaacaaaattctgactcggaaacagaatat
ttagatgcatctgaagagactaataaaattaagacaaatatattcaaaattaaaaatgaa
atcaaaaaagctgatataaaggaatataataaagaaatgttattttttattgataaatgc
attgaatgtaaaaataatataactgaaataagtttagatattaatttgtgcccaattaca
tataatgtcaatttgggatctaggatttataatctaatgaaagttgatcatgaaagtgat
tttactatttttgaagttttacaatctctttgttatttaactgatgacctacaaacattt
atgaaatcttataaagttcttcaaattaatggaataataatacatcctttaactaaagtg
aaagagttatcacctattgataagtatgttattgtaacaaatattagtaatattgattta
ggaattgattctaaaattaacaaaaatcgtaatattttaggctttaaaaatctaggaaat
acttgttttatgaatgcttctttacaagcgataatcaattgtaaagaattttcagattac
ttttattcttgtgatttagacaggcttggaaatcataaaattgtgtctgctgccttttca
gagcttataaaaatgtttgataaaaatttagagtatttaatacccagtaagttaaaatat
gtaattggcagcaaagttgatatttacaatgaaaaagatgaacaggattcgatggaattt
gtctttgatttacttaatcttgttcatgaagagcttaaattaaaaaagaaatcaaagctt
gagaatatagatagttataaaaaatggcagattgaaaatcaatcaatagttactagctta
tttttttcaaaaatcaaatcttcgattgtttgtgcaatgtgtagcaacgaaagatttatt
tttgaaccttgtttaagtttatcagtaccagtacctcttgaaaaaaaatattttagcaat
attgtaatattttatgaatcttataacagagttcctttgaaaatatttgctgaggaaact
cttactatttttgaattgaaaatattattgtgtgaagaatataatgttacacataagata
ttatgttgccaaattatgaataacacaattaaagttattgatgattttcaacaacttaaa
tgtcttaaaagtacattattttgttatgaatttattcaagaaaatgtagaagaatatatt
tggattagtattgatagaaaatattttttttggacaattccttttgattttttaatctta
gggcgcatacctaaaaattgtaataaagaagatgaaaaaacatataagcaaaatataata
gatattgtaagatatagactggttccttttatagatcaaaaaaacattaatatgttgtat
ggttctttcaatgatattttttacattaagcataaaaaaatacaatctagttcaaaaagc
atattaaacagatctcaatgctttttacaaatttctaatgcaaattatatttctttattt
ggtcctaactttcagcctataaataatatgatacatctagtatctgataaaatagattta
atcaattgcttaaacctttttttagaaaaagaatatatttttggagatgataagcagttt
tgtaaaaagtgcaatcaacacactatacattacaaagatacagatctggatttacttcct
aaatatttaataattcagttaaaacgatttcgatttaatggtgttgatttcgagaaaata
ggtacatttgttgattttgaaatgggtgttttttatataaaaaagtgtaaatataaaatt
attagtattataaatcatatctctccatctggtggatatgcttttagaagtgtagggtct
aacggtcactatactgcgtatattagacatcagaatgattggtttcattgtaatgatcac
attattacaaaggtttcagaagttaaaaaggacgacgcgtatatttttatacttgaaaaa
attgaatag

DBGET integrated database retrieval system