KEGG   Nosema ceranae: NCER_101148Help
Entry
NCER_101148       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
nce  Nosema ceranae
Brite
Enzymes [BR:nce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NCER_101148
Peptidases [BR:nce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCER_101148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 862 aa AA seqDB search
MKRKIIRENKCKEEVNVEIIEEKSKQTIKFINYKLYSNHVKYFTDDTLLLYLDFEYNKTN
LDDFYVRYYIFDKLQEKNNTLETFCKQKQMLYILAQQKFRYFLETFLSKNRCFEKMICLE
SYPFRVEKLLEEYDINFFLKKRTNFLEEKNECLPKLIGQSTFYDFSTNTKNINNLNLLCL
KPPINMLLTKEQNSDSETEYLDASEETNKIKTNIFKIKNEIKKADIKEYNKEMLFFIDKC
IECKNNITEISLDINLCPITYNVNLGSRIYNLMKVDHESDFTIFEVLQSLCYLTDDLQTF
MKSYKVLQINGIIIHPLTKVKELSPIDKYVIVTNISNIDLGIDSKINKNRNILGFKNLGN
TCFMNASLQAIINCKEFSDYFYSCDLDRLGNHKIVSAAFSELIKMFDKNLEYLIPSKLKY
VIGSKVDIYNEKDEQDSMEFVFDLLNLVHEELKLKKKSKLENIDSYKKWQIENQSIVTSL
FFSKIKSSIVCAMCSNERFIFEPCLSLSVPVPLEKKYFSNIVIFYESYNRVPLKIFAEET
LTIFELKILLCEEYNVTHKILCCQIMNNTIKVIDDFQQLKCLKSTLFCYEFIQENVEEYI
WISIDRKYFFWTIPFDFLILGRIPKNCNKEDEKTYKQNIIDIVRYRLVPFIDQKNINMLY
GSFNDIFYIKHKKIQSSSKSILNRSQCFLQISNANYISLFGPNFQPINNMIHLVSDKIDL
INCLNLFLEKEYIFGDDKQFCKKCNQHTIHYKDTDLDLLPKYLIIQLKRFRFNGVDFEKI
GTFVDFEMGVFYIKKCKYKIISIINHISPSGGYAFRSVGSNGHYTAYIRHQNDWFHCNDH
IITKVSEVKKDDAYIFILEKIE
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaagatcattagggaaaataaatgtaaagaagaagtaaatgtggaaattatt
gaagaaaaatcgaaacagacaatcaaatttataaattataaactgtattccaatcatgta
aaatattttactgatgatactttattgttgtatttagactttgaatataataaaactaat
ttagatgatttttatgtaagatactatatatttgacaaattgcaggagaaaaacaataca
cttgaaacattttgtaaacaaaaacaaatgttatatatattagcacaacaaaagtttaga
tattttttagaaacctttttatcaaaaaatcgctgttttgagaaaatgatttgtttagaa
tcttatccttttagagttgaaaaattattggaagaatatgacattaatttttttttaaag
aaaagaacaaattttttagaagaaaaaaatgaatgtttaccaaaattaatagggcaaagc
acattttatgatttctcgacaaatacaaaaaacataaataatttaaatttgttgtgtctt
aaaccaccaattaacatgcttttaacaaaagaacaaaattctgactcggaaacagaatat
ttagatgcatctgaagagactaataaaattaagacaaatatattcaaaattaaaaatgaa
atcaaaaaagctgatataaaggaatataataaagaaatgttattttttattgataaatgc
attgaatgtaaaaataatataactgaaataagtttagatattaatttgtgcccaattaca
tataatgtcaatttgggatctaggatttataatctaatgaaagttgatcatgaaagtgat
tttactatttttgaagttttacaatctctttgttatttaactgatgacctacaaacattt
atgaaatcttataaagttcttcaaattaatggaataataatacatcctttaactaaagtg
aaagagttatcacctattgataagtatgttattgtaacaaatattagtaatattgattta
ggaattgattctaaaattaacaaaaatcgtaatattttaggctttaaaaatctaggaaat
acttgttttatgaatgcttctttacaagcgataatcaattgtaaagaattttcagattac
ttttattcttgtgatttagacaggcttggaaatcataaaattgtgtctgctgccttttca
gagcttataaaaatgtttgataaaaatttagagtatttaatacccagtaagttaaaatat
gtaattggcagcaaagttgatatttacaatgaaaaagatgaacaggattcgatggaattt
gtctttgatttacttaatcttgttcatgaagagcttaaattaaaaaagaaatcaaagctt
gagaatatagatagttataaaaaatggcagattgaaaatcaatcaatagttactagctta
tttttttcaaaaatcaaatcttcgattgtttgtgcaatgtgtagcaacgaaagatttatt
tttgaaccttgtttaagtttatcagtaccagtacctcttgaaaaaaaatattttagcaat
attgtaatattttatgaatcttataacagagttcctttgaaaatatttgctgaggaaact
cttactatttttgaattgaaaatattattgtgtgaagaatataatgttacacataagata
ttatgttgccaaattatgaataacacaattaaagttattgatgattttcaacaacttaaa
tgtcttaaaagtacattattttgttatgaatttattcaagaaaatgtagaagaatatatt
tggattagtattgatagaaaatattttttttggacaattccttttgattttttaatctta
gggcgcatacctaaaaattgtaataaagaagatgaaaaaacatataagcaaaatataata
gatattgtaagatatagactggttccttttatagatcaaaaaaacattaatatgttgtat
ggttctttcaatgatattttttacattaagcataaaaaaatacaatctagttcaaaaagc
atattaaacagatctcaatgctttttacaaatttctaatgcaaattatatttctttattt
ggtcctaactttcagcctataaataatatgatacatctagtatctgataaaatagattta
atcaattgcttaaacctttttttagaaaaagaatatatttttggagatgataagcagttt
tgtaaaaagtgcaatcaacacactatacattacaaagatacagatctggatttacttcct
aaatatttaataattcagttaaaacgatttcgatttaatggtgttgatttcgagaaaata
ggtacatttgttgattttgaaatgggtgttttttatataaaaaagtgtaaatataaaatt
attagtattataaatcatatctctccatctggtggatatgcttttagaagtgtagggtct
aacggtcactatactgcgtatattagacatcagaatgattggtttcattgtaatgatcac
attattacaaaggtttcagaagttaaaaaggacgacgcgtatatttttatacttgaaaaa
attgaatag

DBGET integrated database retrieval system