KEGG   Nosema ceranae: NCER_101237Help
Entry
NCER_101237       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
nce  Nosema ceranae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCER_101237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 317 aa AA seqDB search
MLSSNAKIFEIQSPPTDTVSEFSFSTLHNMMIASSWDGSISLYNPISPNGFMKNIQYSKP
MLSCSFSKDTPVHCFGGSADGTLHFIDLEKGISNNFKAHNDGIKSVRSLYNSVITASWDK
TIKIWDTRSAQCTKTVECDGKIYCMDLQNNLLAYGTSTNVMYSCNINNMDSKKKHTPRFS
YMIKCLNVGSDDKNVLVGSIEGKCEMINTTSIYNGITFRSHRKDTKVYSVNTVSIFPKNS
NILVTAGGNGDLIFYDNLSRVKTFTKTEDLPVTAGGFSTDGKLYVYGLGDDWSTGYDGVF
RKTSIKVMEVNSLGIKI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgctttcatcaaatgcaaaaattttcgaaatacaatctccacctacagataccgtctca
gagttctcatttagtacattacataacatgatgatagcatcaagctgggatggaagtatt
tctttatataatcctatttctcctaacggttttatgaaaaatatacagtattctaaaccg
atgctttcatgttcttttagtaaggatacgcctgttcattgttttgggggtagtgcggac
ggtaccctacactttatagatttggagaagggaatttcaaataactttaaagcgcacaat
gatggaataaaaagtgttagatcgttatataattcagttattactgccagctgggataaa
actataaaaatatgggatacaagatctgcgcaatgtacgaaaacagttgagtgtgatggt
aaaatttattgtatggatttacagaataatttattagcttatggtacatctactaatgtt
atgtatagttgtaatattaacaatatggatagtaaaaagaaacacacaccaagatttagt
tacatgataaaatgtcttaatgttggatctgatgacaaaaatgtacttgtaggaagcatt
gaaggaaagtgtgaaatgattaatactacttctatttataacggtattacatttagaagt
catagaaaagatacaaaagtttattctgtgaatacagtaagtatctttcctaagaattct
aatattctagttacagcaggtggaaatggtgatttgattttttacgataatttaagtcga
gtaaagacttttacaaaaacggaagatcttcctgttactgctggtggatttagcaccgat
ggtaaattatacgtatatgggcttggggatgactggtctacagggtatgatggtgtgttt
agaaaaacgtctattaaagtaatggaagttaactcgcttggaattaaaatataa

DBGET integrated database retrieval system