KEGG   Nosema ceranae: NCER_101258Help
Entry
NCER_101258       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
nce  Nosema ceranae
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:nce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCER_101258
Messenger RNA biogenesis [BR:nce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     NCER_101258
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     NCER_101258
Translation factors [BR:nce03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NCER_101258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 183 aa AA seqDB search
MYFFTPIMKLQSKWVIWQNTSEDSDVKSWADDLKNVGEFTQIEEFKFFADELKEKKLDKL
LSLKIFKSGIKPMWEDPRNMNGGRLVIDIPTASGYNPEEVFLLTVAFCISNTAAGICGCV
VMSKHEFIKISLWIENEQYHDDIMAKWKDVLVRYDLNIYFLLHKKGIDGNKGRKTWNKKK
AYF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtatttttttacacccataatgaaacttcagtcaaaatgggtaatatggcaaaatacc
agtgaagattcagatgttaaaagttgggcagatgatctaaaaaatgtaggagaatttaca
caaatagaggaatttaaattctttgcagatgaattaaaagaaaaaaagttagataaacta
ctgtcactaaaaatttttaaaagtgggataaaaccaatgtgggaagatcctagaaacatg
aatggtggcaggttggttattgatatacctactgcttctggatataatcctgaagaagtt
tttctattgacagtagccttttgtatatctaatactgctgctggaatatgtggatgtgtt
gtgatgagtaagcatgagtttattaagatatcattatggattgaaaacgaacaataccac
gatgatataatggctaaatggaaggatgttcttgtgcgttatgatctaaatatttatttt
ttgctgcataaaaaaggtattgatggaaataaaggaaggaaaacttggaataagaagaaa
gcatatttttaa

DBGET integrated database retrieval system