KEGG   Nosema ceranae: NCER_101258Help
Entry
NCER_101258       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
nce  Nosema ceranae
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:nce03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 183 aa AA seqDB search
MYFFTPIMKLQSKWVIWQNTSEDSDVKSWADDLKNVGEFTQIEEFKFFADELKEKKLDKL
LSLKIFKSGIKPMWEDPRNMNGGRLVIDIPTASGYNPEEVFLLTVAFCISNTAAGICGCV
VMSKHEFIKISLWIENEQYHDDIMAKWKDVLVRYDLNIYFLLHKKGIDGNKGRKTWNKKK
AYF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtatttttttacacccataatgaaacttcagtcaaaatgggtaatatggcaaaatacc
agtgaagattcagatgttaaaagttgggcagatgatctaaaaaatgtaggagaatttaca
caaatagaggaatttaaattctttgcagatgaattaaaagaaaaaaagttagataaacta
ctgtcactaaaaatttttaaaagtgggataaaaccaatgtgggaagatcctagaaacatg
aatggtggcaggttggttattgatatacctactgcttctggatataatcctgaagaagtt
tttctattgacagtagccttttgtatatctaatactgctgctggaatatgtggatgtgtt
gtgatgagtaagcatgagtttattaagatatcattatggattgaaaacgaacaataccac
gatgatataatggctaaatggaaggatgttcttgtgcgttatgatctaaatatttatttt
ttgctgcataaaaaaggtattgatggaaataaaggaaggaaaacttggaataagaagaaa
gcatatttttaa

DBGET integrated database retrieval system