KEGG   Nosema ceranae: NCER_101275Help
Entry
NCER_101275       CDS       T01614                                 

Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nce  Nosema ceranae
Pathway
nce00010  Glycolysis / Gluconeogenesis
nce00620  Pyruvate metabolism
nce00640  Propanoate metabolism
nce00680  Methane metabolism
nce01100  Metabolic pathways
nce01110  Biosynthesis of secondary metabolites
nce01130  Biosynthesis of antibiotics
nce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCER_101275
   00620 Pyruvate metabolism
    NCER_101275
   00640 Propanoate metabolism
    NCER_101275
  Energy metabolism
   00680 Methane metabolism
    NCER_101275
Enzymes [BR:nce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NCER_101275
Lipid biosynthesis proteins [BR:nce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NCER_101275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF620
Motif
Other DBs
NCBI-ProteinID: EEQ82078
UniProt: C4V9M4
AA seq 624 aa AA seqDB search
MSFKKYKYEYLKSINNTDTYWSNKAKILIEWDKEFKEVFNNIFESSKWFIGGKLNACYNC
IDRHVKESPDKIAIIYTDNDNCITKYTYKQCLDNICRISNTLVSKGLQKGDCVTIYMAMC
PEAVFSALACARMGVIHNVVFGGFSSNSLLLRMEDSNTKFLITCDIAKRASSNINFWETV
DKVLDDKKLDVLLFDFESRPVKDNINIVYWSDILKEDVKFISPVSVDSEDTLFYLYTSGS
TGKPKGMVHTTGGYLVYAAHTTKECFDLKSNDIFACTADIGWITGHTYSIYGPLLNGITT
VIFGGTPVYPNYYRLFSLVETCRITQLYTAPTVVRTLQKYFSTTTFENKYNLSSLRLLGS
VGEPINKEAYKWFTEAFDNIHIVDTYWQTETGGIMVAPLPNTIPGQPECASLPFYGVDVA
IVRPGSSKDSVIEANAYELGHVVFKKSWPGISRGVLNDSKRYLSSYFCYKNCYFTGDEGY
KDSEGLIWIRGRADDVINVSGHRLSTAELESAACTDIHVAESAVVAVEDEITGQALNIFI
VLKNGANIETAKDSVKKTLRSKIGRLVHPKNIYICRGLPKTATGKILRRVLRDLINGNVS
EDLSTCINTEDIQAIKNSLAINKI
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaagaagtataaatatgaatacttgaaatctataaataacacagatacatat
tggtctaataaagctaaaatacttattgagtgggataaagagtttaaagaagtttttaat
aacatctttgaatcttctaaatggtttataggtggtaaacttaatgcctgttataactgt
atagacaggcatgttaaggaatcaccagataaaatagctataatttatacagataatgat
aattgtataacaaaatacacttacaaacaatgtcttgataatatttgtagaataagtaat
acgttagtaagtaaaggattacagaaaggagattgtgtaacaatttatatggctatgtgt
ccagaagcagtttttagtgcgctagcatgtgcgagaatgggtgttattcataatgtagtg
ttcggtggatttagttctaatagtcttttattacgaatggaagattctaatactaaattt
ctaattacttgcgatattgcgaagcgtgcgtcgtcaaatataaatttttgggaaacagtg
gataaagtgttagatgataaaaaattggatgttcttttatttgattttgaaagtagacca
gtaaaagataatattaatattgtatactggtctgatatattaaaagaagatgtaaaattt
ataagtcctgtatctgttgattcagaagatacattattttatttgtacaccagtggtagt
actggtaaacctaaaggaatggtacacactacaggtggatatcttgtatatgcagctcac
actacaaaggaatgttttgatttgaaaagtaatgatatctttgcttgtacagctgatata
ggatggattacaggacatacatattctatttatggacctttacttaacggaattacaact
gttatttttggaggaacacccgtttatccaaattactatcgattattttcattagttgag
acttgtaggattacacaattatacactgcacctacggtagtaagaacattacagaagtat
ttctctactactacatttgaaaataaatataatttgtcatcactaaggttactcggatca
gttggtgagccaataaataaagaagcgtataaatggtttacagaagcatttgacaatatt
catattgttgatacgtattggcagacagaaactggtggaataatggtagcccctttacct
aatactatacctggacagcctgagtgtgcgtctttacctttttatggtgtagatgtggct
atcgtaagacctggatcatcaaaggatagtgtaattgaagcaaatgcttatgaattaggt
catgttgtatttaaaaaatcttggcctggtatatcaaggggtgttttaaatgacagtaaa
agatatttatcttcatatttctgttataaaaattgttattttactggagatgagggatat
aaagattctgaagggttaatttggattcgtggtcgagcggatgatgtcataaacgtgtca
ggacatcgacttagtactgccgaattagaaagcgctgcgtgtaccgatattcatgtagca
gaatcggctgtagttgccgttgaagatgaaataacaggacaagctttaaatatttttata
gtattaaaaaatggtgcgaatatagaaacagctaaagattcagtaaaaaagactttaaga
agtaaaataggtagattagtacatcctaagaatatttatatttgtcgcggtcttcctaaa
actgccacaggtaaaattttaagaagagtgttacgtgatcttataaatggtaatgtttct
gaagatttaagtacatgtattaatacagaagatatacaagctattaagaattctctagct
atcaataaaatatga

DBGET integrated database retrieval system