KEGG   Nosema ceranae: NCER_101452Help
Entry
NCER_101452       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
nce  Nosema ceranae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NCER_101452
Enzymes [BR:nce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NCER_101452
Exosome [BR:nce04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NCER_101452
  Exosomal proteins of colorectal cancer cells
   NCER_101452
  Exosomal proteins of bladder cancer cells
   NCER_101452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 322 aa AA seqDB search
MKIFISTDKKLAEEMNTPFPGVYGFNPRDKVSYQFQLNEETVKTISSIVSLDLIGVLSYE
NLEAYRATGLHSYYVFIKPEDIPSFLYNFKSTATKVKHLGKFCIIPYKGDREQLKVFGMT
EEDLPGLLFINNGEKYPLKKCTENDIVKFVQDVLDKKLEPVYSSQDEPENNNELNVKVIT
RNNLENFKNDNTRDRLLIFSSPGCSYCNQLRPILEEIGSVIKTNANDKLAIGACDITIND
INGFDISSVPKIYLIKGKTGEIILFEAKERTFNTLAEFINLNGEFKVDLKSFIKIEEEKV
ETPVSDIEEKKPAESIQSDRGL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttttatttctacagacaaaaaacttgctgaagaaatgaatacaccatttcct
ggtgtttatggatttaatccgagagataaagtatcttatcaatttcaacttaatgaagaa
actgttaaaacaatatcttcaattgttagtttagatcttattggtgttctttcatatgag
aatttggaagcttacagggctactggattgcattcttactatgtgtttatcaaaccagaa
gatatcccatcatttctttataattttaagtctacagccacgaaagttaagcatttggga
aaattttgtattattccttacaaaggtgatagggaacaattaaaagtttttggaatgaca
gaagaagatttgccagggttattgtttatcaataatggagagaagtatcctttgaagaag
tgtacagaaaatgatattgtgaaatttgttcaggatgttttagataaaaagttagaacca
gtttattcttcacaggacgaaccagaaaataataatgaacttaatgtaaaagttatcact
agaaataatcttgaaaactttaaaaatgataatactagagataggctgcttatttttagt
tcacccggatgttcgtattgcaatcaattaagacctattttagaagaaataggatcagtt
attaaaactaatgccaatgacaaacttgccattggagcatgtgatataacgattaacgac
attaatggatttgatatctcatctgtacctaagatttatcttataaaaggaaaaacaggg
gaaattattttgtttgaagcaaaagaacgaacttttaatactttagccgaatttattaat
ttaaatggagaatttaaagtagatttaaaatcgtttattaaaattgaggaagaaaaagtg
gaaactcctgtttctgatattgaggagaaaaaacctgctgaaagtatccaatctgatcga
gggttataa

DBGET integrated database retrieval system