KEGG   Nosema ceranae: NCER_101487Help
Entry
NCER_101487       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
nce  Nosema ceranae
Brite
Enzymes [BR:nce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NCER_101487
Peptidases [BR:nce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCER_101487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 850 aa AA seqDB search
MNFSWKSSPPSNKNYTLLETFECNTHQFDAILYSYKDNCYFYLIYRGSIYFDINVNYRIT
INERRIEGVHQFSKFSNDFGFMMEKSPLFNIEFFMNVINQYNSKEETSFCGLRNLGATCY
INSLIQSLFHIKRFRNDIYRCNPNGKILFLQRLFFNMQNQEYVDPTEFVVNLVDDVTLHQ
DIHEFSKVLFDVIEKESKKGGFIDNKDIKKEIVEDLIQGHVVNFINADCGCTREIKESFQ
DIQVEIRDFCNNKLASNLIDSLKLFTAVETLNGDNKYKCDTHGLVNAKKGVLFSDLPPVL
FVLLKRFSIDFETGESSKINDFFKYPEILDLKDFCVNNFSTTYKLYSVIVHKGGHDEGHF
YSYIFLNNQWYKFNDNVVTKVPKEEAMDMNFGGKHPLFRKKKDFSAYYLIYIKDLYILDE
EITINSLVLDEINKQNIKKEIRCITFNNIKNYRGPGFYNLDSYNYPLTGYQEYRIKGSDT
VKILKNKIGGRERLYLFKVANDKLIYLSDDQLLDGKDFFIYKKNDYIDFKKQKLVFIKIF
KDDIWFKDTIPENLYLSFIAIVNNNIHKKIEDNVRISDFVLYKEDFLYKKVHKFNINDDI
EHGDIFIVVKNTHTTSFECFYKDFSSRMCVNVLIDSQNCIPLFLPSNLESKFLLKKIRSF
FCNEEISLCPFDPVVLEYLPLEKNMVSIDIKDNKLIYLGYGEVTDYNNINCIHPFIAPKN
ITGKDFYKIFLSSDYSMEMDIKNLRVVDTVKDTLYLRDYSLDESFTCEGMNLFQSFNSNF
IKVAYFIGNYEIKGYPFFLFVNNHTVQDFRNEYKIFSRLVKYDFNGYVDLDDTDILNECS
KETFILIERN
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcagttggaaatcatctcccccttctaataagaactacacactattagaaaca
ttcgaatgtaatacacatcaatttgatgctatattgtattcatacaaagataactgttat
ttttatctaatttatagaggatccatttattttgatataaatgtaaactatagaataacc
ataaatgaaagacgtattgaaggtgtacatcaattctcaaagttttctaatgattttggg
tttatgatggaaaaatcgccactatttaatattgagttttttatgaatgttataaatcaa
tataactctaaagaagaaacttctttttgcggacttagaaatttaggtgctacttgttat
attaactccttaatacaatctttattccatattaaaagatttagaaatgatatatataga
tgtaatcctaatggtaaaattttatttttacaaagattatttttcaatatgcaaaatcag
gaatatgtagatcctacagaatttgtcgtgaatttggttgacgatgttactctccaccag
gatattcacgaattctcaaaagttttatttgatgtaattgagaaagaatcaaaaaaaggt
ggatttattgataataaagatattaaaaaagaaattgttgaggatttaatacaaggacat
gtagtaaattttataaatgcagattgcgggtgcaccagggaaattaaagaaagctttcag
gatattcaagtagagattagggacttttgtaataataaattagcatcaaatcttattgat
tctcttaaattatttacggctgtagaaactcttaatggtgacaacaaatataaatgtgat
acccatggattagtaaatgctaaaaaaggagttttattttctgatttacccccagttcta
tttgtactgttaaaaagatttagtattgattttgagacaggcgaatcgtcaaaaattaac
gatttttttaaatatcccgaaatactagatttaaaggatttttgtgtaaataatttttct
actacttataagttatattctgtgattgttcataagggtggtcacgatgaaggacatttt
tattcttatatttttttgaataaccagtggtataaatttaatgataacgttgttactaaa
gtacctaaagaagaagcaatggatatgaatttcggtggtaaacatcctctttttaggaaa
aaaaaagatttttcagcatattacttaatttatattaaagatttatatattttagatgaa
gaaattacaattaattctttggtattagacgaaattaataagcagaatataaaaaaagaa
ataagatgtattacatttaataatataaaaaattatcgaggtccgggtttttataattta
gattcttataattatccattaactggatatcaagagtatagaattaaaggcagtgatacg
gttaagattttaaaaaataaaattggaggccgcgagcgactttatttatttaaagttgcg
aatgataaacttatctatttgtccgacgatcaattattggacggcaaagatttttttatt
tataaaaaaaatgattatattgattttaaaaagcaaaaattggtttttataaaaattttt
aaggatgatatttggtttaaagatactattccagagaatttatatttatcattcattgct
attgttaataataatatacataagaaaatagaagataatgtaagaatttcagattttgtt
ttatataaagaagattttttatataaaaaagtgcacaaatttaatattaatgatgatatt
gagcatggtgatatttttatagttgtcaaaaatacacataccacatcatttgaatgtttt
tataaagacttttcgtctagaatgtgtgtcaatgttcttattgattcacaaaattgtata
cctttatttttacctagtaatttagaaagtaaatttttattaaaaaaaatcagatctttt
ttttgtaatgaagaaatttctttgtgtccttttgatccagtggtattggaatatcttcca
ttagaaaaaaatatggtatctattgatattaaagataataaattaatatatttaggttat
ggtgaagtaactgattataataatataaattgtatacatccctttatagctcctaaaaat
attactggtaaagatttctataagatttttttatcttccgattactcgatggaaatggat
ataaagaatttacgtgttgttgacactgtaaaagatactttgtatttgagagattactcg
cttgatgaatcatttacttgtgaaggaatgaatctttttcaatctttcaattcaaatttt
ataaaagtcgcatattttattggtaattatgagataaaagggtatcctttctttttattt
gttaataaccatactgtacaagattttagaaatgaatataaaatttttagtagacttgtt
aaatacgattttaatggatatgttgatttagatgatactgatattttaaatgagtgcagc
aaagaaacatttattttaatcgaaagaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system