KEGG   Nosema ceranae: NCER_101539Help
Entry
NCER_101539       CDS       T01614                                 

Definition
(RefSeq) hypothetical protein
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
nce  Nosema ceranae
Brite
Enzymes [BR:nce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     NCER_101539
Protein kinases [BR:nce01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   NCER_101539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 316 aa AA seqDB search
MLEIENLNFIKKIGTGAFGKVFLVSLNQKKPVFFAVKILSKRKILKMRQADQLENEIKAL
RTVNGHAFITKLVSIVRDSKVIGLVMDYISGGELFYWLRRLRRFSEYATLFYASEILLAL
EFIHKKGLLYRDLKPENILLTPSGHIKLTDFGFAVKDTEKTHVISGTPEYMSPEKLLNED
DGVESDYWSFGVILFEMFTGDPPFFDVDTNRIYRKILETDIYIPKYVSYAAADLLSRLLR
KKRQERLGYWGFEDIKRHVFFNTVDWLNVENNGLIPPIKPSAFESSDYEYVDDNEKYDHF
DDYVHKKPYDYIKFYQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaattgaaaatcttaattttataaaaaaaataggaactggagcttttggcaaa
gtattccttgtctctttaaatcaaaaaaaaccagtattttttgcagttaaaatacttagt
aaaagaaaaattttaaaaatgcgacaagctgaccaattggaaaatgaaataaaagctctt
cgtacagtaaacggccacgcatttattactaaacttgttagtattgttagagattcaaaa
gttattgggctagttatggactatatcagcggtggcgaacttttttattggcttagaagg
ttaagaagattttcagaatatgctacactattttatgcttctgaaattttactagcactt
gaatttattcataagaagggacttttatatcgagatcttaagccagaaaatattttattg
acaccatctggacatataaaattaacagattttggatttgctgttaaagacactgaaaaa
acacacgttatttctggaacacccgaatatatgtcacccgaaaaattattgaatgaagat
gatggcgtagaaagtgattattggtcctttggtgtaattttatttgaaatgtttactggt
gatcctcctttttttgatgttgataccaacagaatttacagaaaaatattagaaactgat
atttatattccaaaatatgttagctatgctgccgccgatttattgagcagattgcttcga
aaaaaaagacaagaaaggttgggttattggggatttgaagatatcaaaaggcatgttttt
tttaatactgttgattggttaaatgttgaaaataatggccttattccaccaataaagcct
agtgcatttgaatcatctgattatgaatatgtagacgataatgaaaaatatgatcatttt
gatgactatgtacataaaaagccttatgattatataaaattttatcaataa

DBGET integrated database retrieval system