KEGG   Nosema ceranae: NCER_102027Help
Entry
NCER_102027       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
nce  Nosema ceranae
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:nce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NCER_102027
Enzymes [BR:nce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NCER_102027
Protein kinases [BR:nce01001]
 Serine/threonine protein kinases: Other group
  TTK family
   NCER_102027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 549 aa AA seqDB search
MESLFTSLDLYNYVMDKLKQPISLSLKLSLLFKSIQKDFLVDKYMVVIFLNYIRCLINLQ
SDDILLIFKTSKLKYFKYWCFWREYLSYIISVGEKIDKIIDEGIKFLNVKEFKDKQKILD
FLLQIKEDKDRQKYIYNWTSEWMTIENIDESCNVKEESGLIIAKCAFENSKDVQFTDHLY
SPAYKKSHKSFPNTPITDDVNKYSYKDGIIDCNKVIKCKIEDITLGEDTNLFKMGLKSSN
NDKLEIKNYKEDNKVVEVDFKHENEQINKENLKNTNYRKNKEQEFFTLNGKKLLKINIIG
KGGSSKVYKVFYESEFYALKVINIEMDSTLKNLLLEEIDLLKKLQSVDGIIKMIDYEILT
DNIYILLEYGETVLNQFMKSDKKDIFLHSNRVKYIWQEILLIVLNIHDQRIIHGDLKPAN
FVFVKNKLKIIDFGISKALNSNTTRLDLDMVCGTLNYCAPELFFENRKRRSSDVWSLGII
LYELWYGKTPLDAYKTYLEKKENIVNIRKNLKLTSKVDLVIYMCLNEDCRQRPTVKDLLK
DKFICNSLD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggagtctctttttacatctctagatttatacaattatgtaatggataaacttaagcaa
cctatttctttatcacttaaattaagtttattatttaaatctattcagaaagactttctt
gttgataaatacatggtagtaatttttttaaattatatcagatgtcttataaatttacaa
agtgatgatatcttattaatctttaagactagtaaacttaaatattttaaatattggtgc
ttttggagagaatatttaagttatattattagtgttggagaaaaaattgataaaataata
gacgaaggtattaaatttttaaatgttaaagaatttaaagataaacaaaagattttggat
tttttattacaaattaaagaagataaagatagacagaaatatatttataattggaccagt
gaatggatgacaatagagaatatagatgaaagttgtaatgttaaagaagaatcaggtcta
attattgctaaatgtgcctttgaaaattcaaaagatgtgcaatttacagatcatttatat
tctcctgcttataaaaaaagtcataaatcatttcctaatacacctattactgatgatgta
aataaatattcatacaaagatggcattatagattgtaataaagttataaagtgtaaaata
gaagatattacactaggtgaagatactaatctttttaaaatgggacttaaatcatcaaac
aatgataaactagaaattaagaattacaaagaagataataaagttgtagaagtcgacttt
aagcatgaaaacgagcaaataaataaagaaaatttaaaaaatacaaattacagaaaaaat
aaggaacaagaattttttaccttaaatggtaaaaaattgctaaaaatcaatattattggt
aagggcggtagcagtaaagtatataaagttttttatgaaagtgagttttatgctttgaaa
gttataaatattgaaatggatagcacactaaaaaatcttcttttagaagaaatagattta
cttaaaaaattacaaagtgtagacggaataataaaaatgattgattatgaaattttaaca
gataatatttatattttacttgaatatggagaaacagttttaaatcaatttatgaagagt
gataaaaaagatatatttttacatagtaatagagttaagtacatttggcaagaaattttg
ttaattgtattaaacatacatgatcaaagaatcattcacggagatcttaagcctgcaaat
tttgtatttgtaaaaaataaactaaaaattattgattttggtatatctaaagctttaaat
agtaatacgacacgtctagatcttgatatggtttgcgggactttaaattattgcgcacca
gaattattttttgaaaatagaaaaagaagaagtagtgatgtttggtcattgggtattatt
ttatatgaattgtggtatgggaaaacacctctagatgcctataaaacatatttagaaaag
aaagaaaacattgttaatatacgaaaaaatttaaagttaacatctaaagtagatttagtg
atatatatgtgtttaaatgaagattgtaggcaaaggcctacagtgaaagatttattaaaa
gataaatttatttgtaattctttagattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system