KEGG   Nosema ceranae: NCER_102276Help
Entry
NCER_102276       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
nce  Nosema ceranae
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:nce00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 289 aa AA seqDB search
MKSIKFLIADIFNKKLNIHIDKIVKQSDAYTNLVYKVDSGNESFIYKKFEHLNLFENLVL
EKMSLPEILVSEHDYRIERFIKHKKVDFKNDCKEIAVALKKFHTTEIKDFINFKCLLLTE
INKITNVKISEILENASIKIFNIIKNNQGKNVLCHNDLQPNNILKTNTIIFIDFEYCSIG
NNLVDIANLFCETEIDYEKNVYIKGSGYTEEERILFLRKYFNKNDVKCELQKINNLEVVS
HFLWFVWSVYIIKSNNNSEFDYKKYSLSRLQYLNNIFTSDEIKILLSYL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaattaaatttttaatagctgatatttttaataaaaaattaaatattcacatc
gataaaattgtaaaacagtcagatgcctacaccaaccttgtttataaagtagacagtgga
aatgaaagttttatatataaaaaatttgaacatttaaacttatttgaaaatctagtgcta
gaaaaaatgtctctacctgagattcttgtatcagaacatgattatagaattgagaggttt
ataaaacataaaaaagtagattttaaaaatgattgtaaagaaatagctgtagctttaaaa
aagtttcatacaacagaaataaaagattttataaattttaaatgtcttttacttacagaa
ataaataaaattactaatgtaaaaatatcagaaatattagaaaatgcatcaataaaaata
tttaatattataaaaaataatcagggtaagaatgttttatgccataatgatctacagcct
aataatatccttaagactaatacaataatatttatagattttgaatactgttctatagga
aataatttagtagatattgcgaatttattttgtgagacagaaatagactacgagaagaat
gtctatattaaaggttcgggatacacagaagaagaaagaattctttttttaaggaaatat
tttaataaaaatgatgtaaaatgtgaattacaaaaaattaataatctagaagtagtcagt
cactttttatggtttgtatggagtgtttatattataaaatctaacaataattcagagttt
gactataaaaagtacagtttatctagattacaatatcttaacaatatatttacatctgat
gagataaaaatattattatcttattta

DBGET integrated database retrieval system