KEGG   Nosema ceranae: NCER_102276Help
Entry
NCER_102276       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
nce  Nosema ceranae
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:nce00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCER_102276
Enzymes [BR:nce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NCER_102276
    2.7.1.82  ethanolamine kinase
     NCER_102276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 289 aa AA seqDB search
MKSIKFLIADIFNKKLNIHIDKIVKQSDAYTNLVYKVDSGNESFIYKKFEHLNLFENLVL
EKMSLPEILVSEHDYRIERFIKHKKVDFKNDCKEIAVALKKFHTTEIKDFINFKCLLLTE
INKITNVKISEILENASIKIFNIIKNNQGKNVLCHNDLQPNNILKTNTIIFIDFEYCSIG
NNLVDIANLFCETEIDYEKNVYIKGSGYTEEERILFLRKYFNKNDVKCELQKINNLEVVS
HFLWFVWSVYIIKSNNNSEFDYKKYSLSRLQYLNNIFTSDEIKILLSYL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaattaaatttttaatagctgatatttttaataaaaaattaaatattcacatc
gataaaattgtaaaacagtcagatgcctacaccaaccttgtttataaagtagacagtgga
aatgaaagttttatatataaaaaatttgaacatttaaacttatttgaaaatctagtgcta
gaaaaaatgtctctacctgagattcttgtatcagaacatgattatagaattgagaggttt
ataaaacataaaaaagtagattttaaaaatgattgtaaagaaatagctgtagctttaaaa
aagtttcatacaacagaaataaaagattttataaattttaaatgtcttttacttacagaa
ataaataaaattactaatgtaaaaatatcagaaatattagaaaatgcatcaataaaaata
tttaatattataaaaaataatcagggtaagaatgttttatgccataatgatctacagcct
aataatatccttaagactaatacaataatatttatagattttgaatactgttctatagga
aataatttagtagatattgcgaatttattttgtgagacagaaatagactacgagaagaat
gtctatattaaaggttcgggatacacagaagaagaaagaattctttttttaaggaaatat
tttaataaaaatgatgtaaaatgtgaattacaaaaaattaataatctagaagtagtcagt
cactttttatggtttgtatggagtgtttatattataaaatctaacaataattcagagttt
gactataaaaagtacagtttatctagattacaatatcttaacaatatatttacatctgat
gagataaaaatattattatcttattta

  All links  
No link information was found.   
DBGET integrated database retrieval system