KEGG   Neurospora crassa: NCU00008Help
Entry
NCU00008          CDS       T01034                                 

Definition
similar to ceramide synthase membrane component Lag1
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ncr  Neurospora crassa
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ncr00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 431 aa AA seqDB search
MAPSTKSEPFPELSSAADRQLHSEATAARRRRKSSGLGQALRVGDTGAPALATSLALSQK
DSKDVAAPPGKKYSKRRKARSLLRRAKNYAIKHTWALPLAILMAFLSLYAINPTESNPIH
HFIFLSYKLPTSSSDEIPQYGKGLWDIAFVSFYTIVLSFTREFIMQEVLRPMARWAGLKS
RGKQARYMEQMYTALYFGIMGPVGMFVMSRTPVWYFNTVGMYENFPHKTHVAVFKFYYLF
QAAYWAQQAIVLLLGMEKPRKDFRELVCHHIVSLALIGLSYRFHFTYIGLAVYITHDISD
FFLATSKTLNYLDHALTGPYYFTFMCVWIYLRHYLNLRIIWSLFTEFKTVGPYELNWETQ
QYKCSLSFVITLALLGSLQALNLFWLFFIIRIAYRFVVHKVAKDDRSDDESELEDDVTEE
KPTVNGSTTKR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaccctcgacaaaatcagaaccgtttccggagctcagctcggcggcagaccgccaa
ttacactccgaggctaccgcagcccgtcgccgaagaaagtcgagcggccttggacaagca
ttgcgcgtcggtgacactggcgcacccgccttggccaccagtcttgccctctcacagaag
gattccaaagatgtcgctgcgccaccaggcaagaaatattccaagcggcgcaaggcgcgc
tccctcctccgccgcgccaaaaactatgccatcaaacacacgtgggccttgcccttggcc
atcctgatggcattcctatctctctacgccatcaacccgaccgagagcaacccgatccac
cactttatcttcctctcatataagctgccgacttcgagttccgatgagatcccgcaatac
ggcaaaggcctctgggacattgcctttgtatccttctacaccatcgtcttgtccttcacc
cgcgagttcatcatgcaggaggttctgcgccccatggcgcgctgggccggcctcaagtcg
cgcggaaagcaggctcggtatatggagcaaatgtacacggctctctactttggaatcatg
ggacccgttggtatgttcgttatgagccgcacgcccgtctggtacttcaacaccgtcggc
atgtacgagaacttcccgcacaagacccatgtggctgtgttcaagttttactaccttttc
caggctgcctactgggcgcagcaggccatcgtgcttctcctgggaatggaaaagccccgg
aaggatttcagggagttggtctgccatcatattgtcagcttggctttgattggcttgagc
taccgcttccacttcacctacatcggtcttgcggtctacatcacccatgacatcagtgat
ttcttcttggcgacatccaagactctcaactacctcgaccacgcgctcaccggcccctac
tacttcaccttcatgtgtgtatggatctacctgcgccactacctcaacttgcgcatcatt
tggagtctgttcaccgagttcaagaccgtcggcccttacgagctcaactgggagactcag
cagtacaagtgcagcctctccttcgtcatcacgctcgctttgctcggctcccttcaggca
ctcaacctcttttggctgttcttcatcatccgcatcgcttaccgcttcgttgtccataaa
gttgccaaggatgaccgcagcgatgatgagtccgagttggaagatgatgttaccgaggag
aagcctaccgttaacggctctaccaccaagaggtag

DBGET integrated database retrieval system