KEGG   Neurospora crassa: NCU00147Help
Entry
NCU00147          CDS       T01034                                 

Definition
(RefSeq) ARD/ARD family protein
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ncr  Neurospora crassa
Pathway
ncr00270  Cysteine and methionine metabolism
ncr01100  Metabolic pathways
Module
ncr_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NCU00147
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     NCU00147
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     NCU00147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding
Motif
Other DBs
NCBI-GeneID: 3872807
NCBI-ProteinID: XP_956660
UniProt: Q7RXR1
Position
Linkage Group III; III
AA seq 178 aa AA seqDB search
MKAYFYDNLPGDQRLPHDSGKEVTVAELEKVGVLYFRFPDVEGVNTLAAERGYKNRDEII
VSPEKMGAIYETKVRQFFDEHLHEDEEIRYIRDGAGYFDVRNEGDEWIRIKLVKDDLIIL
PAGIYHRFTTDDTNYIQAMRLFKEEPKWTPLNRTEGLDENPYRQEYVTQFLKAQAEQA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctacttctacgacaaccttcctggtgatcaacgcctcccccacgactccggc
aaggaagtgacggtcgcggagcttgaaaaggtcggcgtcctttacttccggttcccggat
gtcgagggcgtaaacacactggcggcggagcgcggctacaagaaccgggacgagatcatc
gtctcgcccgagaagatgggggccatctacgagacgaaggtgcgccagttcttcgacgag
cacctgcacgaggacgaggagattcggtacattcgcgatggtgccgggtactttgacgtg
cgcaacgagggcgacgagtggattcgcatcaagcttgtcaaggatgatttgatcatcctg
cctgcaggcatttatcataggtttactactgatgataccaactatatccaggctatgcgt
ctgttcaaggaagagcccaagtggacgcctctgaaccgtaccgaggggcttgatgagaac
ccctaccgccaggagtatgtcactcagttcctgaaggcccaagctgaacaggcatag

DBGET integrated database retrieval system