KEGG   Neurospora crassa: NCU00200Help
Entry
NCU00200          CDS       T01034                                 

Gene name
trp-1
Definition
(RefSeq) tryptophan-1
  KO
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
ncr  Neurospora crassa
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCU00200 (trp-1)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCU00200 (trp-1)
Enzymes [BR:ncr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NCU00200 (trp-1)
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     NCU00200 (trp-1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     NCU00200 (trp-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group III; III
AA seq 762 aa AA seqDB search
MSSSSVVDHSPHDSAPSPLVPTASNLILIDNYDSFTWNVYQYLVLEGAKVTVFRNDQITI
DELIAKNPTQLVISPGPGHPGTDSGISRDAIRHFAGKIPIFGVCMGQQCIFDVYGGDVCF
AGEILHGKTSPLRHDGKGAYAGLSQDLPVTRYHSLAGTHVTLPECLEVTSWIAKEDGSKG
VIMGVRHKEYTIEGVQFHPESILSAEGRGMFRNFLHMQGGTWAENERLQKAAQAQAANTK
SDAPTPKKSNILQKIYAHRKAAVDAQKQIPSLRPSDLQAAYNLSIAPPQISLVDRLRNSP
FDVALCAEIKRASPSKGVFALDIDAPSQARKYALAGASVISVLTEPEWFKGSIDDLRAVR
QVLNGMPNRPAVLRKEFIFDEYQILEARLAGADTVLLIVKMLEYELLERLYKYSLSLGME
PLVEVQNTEEMATAIKLGAKVIGVNNRNLESFEVDLGTTGRLRSMVPSDTFLCALSGINT
HQDVLDCKRDGVNGILVGEAIMRAPDATQFIRELCAGLTGPVPKSAAEPLLVKICGTRSA
EAAAEAIKAGADLVGMIMVPGTKRCVDHETALSISQAVHMSKKTGSTEVSSQASKSARDF
FNINAEIIRKRGPLLVGVFMNQPLEEVLEKQHLYDLDIVQLHGDEPLEWANLIPVPVVRK
FKPGQVGLATRGYHAVPLLDSGAGSGTLLDLESVKKELEKDEQVTVLLAGGLEPSNVVET
VKSLGPLSERVIGVDVSSGVEEGGKQSLEKIREFVKAAKSVR
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctcctcagtcgtcgaccactctccccacgattccgctccttcgcccctggtg
ccaaccgcctccaacctcatcctcatcgacaactatgattcgtttacctggaacgtctac
cagtacctcgtcctcgagggcgccaaggtgaccgtcttccgcaacgaccagatcaccatc
gacgagctcatcgcaaagaaccccacccagctcgtcatcagccctgggcccggtcatccc
ggcaccgactccggtatctcgcgcgatgccatcaggcacttcgccggcaagatccccatc
tttggcgtgtgcatgggccagcagtgcatctttgacgtctatggcggcgacgtgtgcttc
gccggtgagattctgcacggaaagacctctcctctgcgccacgacggcaagggcgcatat
gccggtctgtctcaggatctgccagtgacgagataccactctcttgccggtactcatgtc
acccttcccgagtgcttggaggttacctcttggattgcgaaggaggacggttccaagggt
gtcatcatgggtgtccgccacaaggagtacaccattgagggtgttcagttccacccggag
agtattctgtctgctgagggtcgtggcatgttccggaacttccttcacatgcagggaggc
acttgggcggagaacgagagactgcaaaaggccgcccaggcacaggctgccaacacaaag
tccgacgctcccacgcccaagaagagcaacatccttcaaaagatttacgcccaccgtaag
gctgctgtggatgctcagaagcagattccttccctgagaccttctgacctccaagccgct
tataacctgagcatcgcccctcctcaaatctctcttgtcgaccgtcttcgcaattccccc
ttcgatgtcgctctttgcgccgagatcaagagggcatctccctccaagggtgtctttgcg
cttgatattgacgctccgtcgcaagctcgcaagtatgcgcttgccggcgcgagtgtcatc
tcggtcctgaccgagccagagtggttcaagggcagcatcgatgacctccgtgctgtccgt
caggtccttaacggcatgcccaaccggcccgccgtcctgcgcaaggagttcatctttgac
gagtaccagatcctcgaagccagacttgccggtgctgacactgttctcctcattgtcaag
atgctcgagtatgagctcctcgagcgcctatacaagtactccttgtctctcggcatggag
cccctagtcgaggtccagaacaccgaggagatggccacagccatcaagctcggcgccaag
gttatcggcgtcaacaaccgcaatctcgagagcttcgaagtcgaccttggcactaccggc
cgtctccgtagcatggtccccagcgacaccttcctctgcgctctcagcggcatcaacact
caccaagatgttcttgactgcaagcgcgacggtgtcaacggcattcttgtcggcgaggcc
atcatgcgtgcccctgatgccacccagttcatccgtgagctctgcgccggcctgacgggc
cccgtgcccaagtccgccgccgagccgctgcttgtcaagatctgcggcacccgttctgcc
gaggccgctgcggaagccatcaaggccggtgctgatcttgtgggcatgatcatggtgcca
ggcaccaagcgttgcgtcgaccatgagaccgccctttccatctcccaggctgtgcacatg
agcaagaagaccggatccaccgaggtctcctcgcaagcctccaagtccgcaagggacttt
ttcaatatcaacgccgagatcatccgcaagcggggacctctgctggtaggtgtcttcatg
aaccagccccttgaggaggtgctcgagaagcagcatctctacgatctcgatatcgtccag
ctccacggtgacgagccgctcgagtgggccaaccttattccagtccccgttgtccgcaag
ttcaagcccggccaggtcggtcttgcgacccgtgggtaccatgccgtgcccctgctggat
tcgggcgctggatccggcacgttgttggacttggagtctgtcaagaaggagttggagaag
gatgagcaggtaaccgtcttgcttgcgggcggattggagcctagcaatgttgtcgagacg
gtaaaatctttggggcctctgagtgagagggtgattggtgttgatgttagcagtggcgtt
gaggagggaggcaagcagagcttggagaagatcagggagtttgttaaggctgccaagtct
gtcaggtaa

DBGET integrated database retrieval system